Molecule Information

General Information of the Molecule (ID: Mol00812)
Name
Bacitracin transport permease protein BCRB (BCRB) ,Bacillus licheniformis
Molecule Type
Protein
Gene Name
bcrB
Sequence
MAKKAKYPDVPIRFSETFSDTNLYIVLLIGVPLYGVITSYLFNREYAESTLKNLLTIPVS
RISLIVSKLVLLLIWIMMLTLIAWVLTLLFGLIGQFEGLSSAVLIEGFKQFMIGGALLFF
LVSPIIFVTLLFKNYVPTIIFTIIISMVSIMVYGTEYSALFPWSAVWVIASGTFFPEYPP
EYSFISVAATTVLGLAATIVYFKKIDIH
    Click to Show/Hide
Function
Part of the binding-protein-dependent transport system for bacitracin that confer resistance to this antibiotic; probably responsible for the translocation of the substrate across the membrane.
    Click to Show/Hide
Uniprot ID
BCRB_BACLI
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Bacillales
Family: Bacillaceae
Genus: Bacillus
Species: Bacillus licheniformis
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Click to Show/Hide the Full List of Drugs
Bacitracin A
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacillus licheniformis infection [1]
Resistant Disease Bacillus licheniformis infection [ICD-11: 1C4Y.2]
 Disease Info 
Resistant Drug Bacitracin A
 Drug Info 
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli strain HB101 634468
Escherichia coli strain DH5alpha 668369
Bacillus subtilis strain 1A685 1423
Bacillus subtilis strain vectors pHV143 1423
Bacillus ticheniformis strain FD 1402
Experiment for
Molecule Alteration		 Dideoxynucleotide chain-termination method assay
Experiment for
Drug Resistance		 MIC assay
Mechanism Description How could the proposed export function of the Bcr permease account for the bacitracin resistance The transported molecule could be either the substance inactivating the antibiotic or the antibiotic alone. As already observed. some of the metabolites could inhibit the bactericidal activity of bacitracin at very low concentrations. However, in S. subfitis and Escherichia coli strains carrying cloned bcr genes, no substances that could suppress bacitracin activity were detected. It seems that the bacitracin is indeed the target of the Bcr ABC transporter.
Disease Class: Escherichia coli infection [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
 Disease Info 
Resistant Drug Bacitracin A
 Drug Info 
Molecule Alteration Expression
Acquired
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli strain HB101 634468
Escherichia coli strain DH5alpha 668369
Bacillus subtilis strain 1A685 1423
Bacillus subtilis strain vectors pHV143 1423
Bacillus ticheniformis strain FD 1402
Experiment for
Molecule Alteration		 Dideoxynucleotide chain-termination method assay
Experiment for
Drug Resistance		 MIC assay
Mechanism Description The nucleotide sequence of the Bacillus licheniformis bacitracin-resistance locus was determined. The presence of three open reading frames, bcrA, bcrB and bcrC, was revealed. The BcrA protein shares a high degree of homology with the hydrophilic ATP-binding components of the ABC family of transport proteins. The bcrB and bcrC genes were found to encode hydrophobic proteins, which may function as membrane components of the permease. Apart from Bacillus subtilis, these genes also confer resistance upon the Gram-negative Escherichia coli.
Disease Class: Bacillus subtilis infection [1]
Resistant Disease Bacillus subtilis infection [ICD-11: 1G40.1]
 Disease Info 
Resistant Drug Bacitracin A
 Drug Info 
Molecule Alteration Expression
Acquired
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli strain HB101 634468
Escherichia coli strain DH5alpha 668369
Bacillus subtilis strain 1A685 1423
Bacillus subtilis strain vectors pHV143 1423
Bacillus ticheniformis strain FD 1402
Experiment for
Molecule Alteration		 Dideoxynucleotide chain-termination method assay
Experiment for
Drug Resistance		 MIC assay
Mechanism Description The nucleotide sequence of the Bacillus licheniformis bacitracin-resistance locus was determined. The presence of three open reading frames, bcrA, bcrB and bcrC, was revealed. The BcrA protein shares a high degree of homology with the hydrophilic ATP-binding components of the ABC family of transport proteins. The bcrB and bcrC genes were found to encode hydrophobic proteins, which may function as membrane components of the permease. Apart from Bacillus subtilis, these genes also confer resistance upon the Gram-negative Escherichia coli.
Bacitracin F
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacillus licheniformis infection [1]
Resistant Disease Bacillus licheniformis infection [ICD-11: 1C4Y.2]
 Disease Info 
Resistant Drug Bacitracin F
 Drug Info 
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli strain HB101 634468
Escherichia coli strain DH5alpha 668369
Bacillus subtilis strain 1A685 1423
Bacillus subtilis strain vectors pHV143 1423
Bacillus ticheniformis strain FD 1402
Experiment for
Molecule Alteration		 Dideoxynucleotide chain-termination method assay
Experiment for
Drug Resistance		 MIC assay
Mechanism Description How could the proposed export function of the Bcr permease account for the bacitracin resistance The transported molecule could be either the substance inactivating the antibiotic or the antibiotic alone. As already observed. some of the metabolites could inhibit the bactericidal activity of bacitracin at very low concentrations. However, in S. subfitis and Escherichia coli strains carrying cloned bcr genes, no substances that could suppress bacitracin activity were detected. It seems that the bacitracin is indeed the target of the Bcr ABC transporter.
Disease Class: Escherichia coli infection [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
 Disease Info 
Resistant Drug Bacitracin F
 Drug Info 
Molecule Alteration Expression
Acquired
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli strain HB101 634468
Escherichia coli strain DH5alpha 668369
Bacillus subtilis strain 1A685 1423
Bacillus subtilis strain vectors pHV143 1423
Bacillus ticheniformis strain FD 1402
Experiment for
Molecule Alteration		 Dideoxynucleotide chain-termination method assay
Experiment for
Drug Resistance		 MIC assay
Mechanism Description The nucleotide sequence of the Bacillus licheniformis bacitracin-resistance locus was determined. The presence of three open reading frames, bcrA, bcrB and bcrC, was revealed. The BcrA protein shares a high degree of homology with the hydrophilic ATP-binding components of the ABC family of transport proteins. The bcrB and bcrC genes were found to encode hydrophobic proteins, which may function as membrane components of the permease. Apart from Bacillus subtilis, these genes also confer resistance upon the Gram-negative Escherichia coli.
Disease Class: Bacillus subtilis infection [1]
Resistant Disease Bacillus subtilis infection [ICD-11: 1G40.1]
 Disease Info 
Resistant Drug Bacitracin F
 Drug Info 
Molecule Alteration Expression
Acquired
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli strain HB101 634468
Escherichia coli strain DH5alpha 668369
Bacillus subtilis strain 1A685 1423
Bacillus subtilis strain vectors pHV143 1423
Bacillus ticheniformis strain FD 1402
Experiment for
Molecule Alteration		 Dideoxynucleotide chain-termination method assay
Experiment for
Drug Resistance		 MIC assay
Mechanism Description The nucleotide sequence of the Bacillus licheniformis bacitracin-resistance locus was determined. The presence of three open reading frames, bcrA, bcrB and bcrC, was revealed. The BcrA protein shares a high degree of homology with the hydrophilic ATP-binding components of the ABC family of transport proteins. The bcrB and bcrC genes were found to encode hydrophobic proteins, which may function as membrane components of the permease. Apart from Bacillus subtilis, these genes also confer resistance upon the Gram-negative Escherichia coli.
Bacitracin methylene disalicylate
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacillus licheniformis infection [1]
Resistant Disease Bacillus licheniformis infection [ICD-11: 1C4Y.2]
 Disease Info 
Resistant Drug Bacitracin methylene disalicylate
 Drug Info 
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli strain HB101 634468
Escherichia coli strain DH5alpha 668369
Bacillus subtilis strain 1A685 1423
Bacillus subtilis strain vectors pHV143 1423
Bacillus ticheniformis strain FD 1402
Experiment for
Molecule Alteration		 Dideoxynucleotide chain-termination method assay
Experiment for
Drug Resistance		 MIC assay
Mechanism Description How could the proposed export function of the Bcr permease account for the bacitracin resistance The transported molecule could be either the substance inactivating the antibiotic or the antibiotic alone. As already observed. some of the metabolites could inhibit the bactericidal activity of bacitracin at very low concentrations. However, in S. subfitis and Escherichia coli strains carrying cloned bcr genes, no substances that could suppress bacitracin activity were detected. It seems that the bacitracin is indeed the target of the Bcr ABC transporter.
Disease Class: Escherichia coli infection [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
 Disease Info 
Resistant Drug Bacitracin methylene disalicylate
 Drug Info 
Molecule Alteration Expression
Acquired
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli strain HB101 634468
Escherichia coli strain DH5alpha 668369
Bacillus subtilis strain 1A685 1423
Bacillus subtilis strain vectors pHV143 1423
Bacillus ticheniformis strain FD 1402
Experiment for
Molecule Alteration		 Dideoxynucleotide chain-termination method assay
Experiment for
Drug Resistance		 MIC assay
Mechanism Description The nucleotide sequence of the Bacillus licheniformis bacitracin-resistance locus was determined. The presence of three open reading frames, bcrA, bcrB and bcrC, was revealed. The BcrA protein shares a high degree of homology with the hydrophilic ATP-binding components of the ABC family of transport proteins. The bcrB and bcrC genes were found to encode hydrophobic proteins, which may function as membrane components of the permease. Apart from Bacillus subtilis, these genes also confer resistance upon the Gram-negative Escherichia coli.
Disease Class: Bacillus subtilis infection [1]
Resistant Disease Bacillus subtilis infection [ICD-11: 1G40.1]
 Disease Info 
Resistant Drug Bacitracin methylene disalicylate
 Drug Info 
Molecule Alteration Expression
Acquired
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli strain HB101 634468
Escherichia coli strain DH5alpha 668369
Bacillus subtilis strain 1A685 1423
Bacillus subtilis strain vectors pHV143 1423
Bacillus ticheniformis strain FD 1402
Experiment for
Molecule Alteration		 Dideoxynucleotide chain-termination method assay
Experiment for
Drug Resistance		 MIC assay
Mechanism Description The nucleotide sequence of the Bacillus licheniformis bacitracin-resistance locus was determined. The presence of three open reading frames, bcrA, bcrB and bcrC, was revealed. The BcrA protein shares a high degree of homology with the hydrophilic ATP-binding components of the ABC family of transport proteins. The bcrB and bcrC genes were found to encode hydrophobic proteins, which may function as membrane components of the permease. Apart from Bacillus subtilis, these genes also confer resistance upon the Gram-negative Escherichia coli.
References
Ref 1 Bacillus licheniformis bacitracin-resistance ABC transporter: relationship to mammalian multidrug resistance. Mol Microbiol. 1995 Jun;16(5):969-76. doi: 10.1111/j.1365-2958.1995.tb02322.x.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.