Molecule Information

General Information of the Molecule (ID: Mol00797)

• Name: Aminoglycoside N(3)-acetyltransferase (A3AC) ,Escherichia coli
• Synonyms: aac(3); aac(3)-IV; aac(3)-IVa; aac(3)IV; aac3-VI; BJJ90_27515; BMC79_004910; BMC79_005421; BVL39_27730; BZL69_29365; CDC27_25895; CR538_26885; CWS33_26775; D0X26_29340; D9D77_25705; D9D77_28900; D9E49_23800; D9E49_28790; E4K51_25065; F3N40_24255; F3N40_27730; GTP88_26100; GTP88_26800; HNC66_26125; HNC66_27870; HND12_28675; HND12_30655; HVX16_26725; J0541_005607; J0541_005921; pEC012_00026; SAMEA3472080_05397
• Molecule Type: Protein
• Gene Name: aacC4
• Sequence:
  MQYEWRKAELIGQLLNLGVTPGGVLLVHSSFRSVRPLEDGPLGLIEALRAALGPGGTLVM
  PSWSGLDDEPFDPATSPVTPDLGVVSDTFWRLPNVKRSAHPFAFAAAGPQAEQIISDPLP
  LPPHSPASPVARVHELDGQVLLLGVGHDANTTLHLAELMAKVPYGVPRHCTILQDGKLVR
  VDYLENDHCCERFALADRWLKEKSLQKEGPVGHAFARLIRSRDIVATALGQLGRDPLIFL
  HPPEAGCEECDAARQSIG
• Function: Resistance to antibiotics containing the 2-deoxy-streptamine ring including gentamicin, kanamycin, tobramycin, neomycin and apramycin.
• Uniprot ID: Q306W4_ECOLX

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Gentamicin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Escherichia coli infection [1]

• Resistant Disease: Escherichia coli infection [ICD-11: 1A03.0]
• Resistant Drug: Gentamicin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli Co227; 562
• In Vitro Model: Escherichia coli Co228; 562
• In Vitro Model: Escherichia coli Co356; 562
• Experiment for Molecule Alteration: PCR; PCR-restriction fragment length polymorphism analysis; Sequencing assay
• Experiment for Drug Resistance: Agar dilution method assay
• Mechanism Description: Multiple-antibiotic-resistant phenotype is associated with gene mutation and mar locus regulation.

Clinical Trial Drug(s) 1 drug(s) in total

Apramycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Escherichia coli infection [2]

• Resistant Disease: Escherichia coli infection [ICD-11: 1A03.0]
• Resistant Drug: Apramycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli strain BE904; 562
• In Vitro Model: Escherichia coli strain CSR603; 562
• In Vitro Model: Escherichia coli strain DH1; 536056
• In Vitro Model: Escherichia coli strain JA221; 562
• In Vitro Model: Escherichia coli strain k12; 83333
• In Vitro Model: Escherichia coli strain RR1; 562
• Experiment for Molecule Alteration: DNA sequencing assay
• Experiment for Drug Resistance: O-galactosidase assay
• Mechanism Description: Apramycin resistance is mediated by an aminocyclitol acetyltransferase that acetylates the nitrogen at the 3 -position of apramycin.The gene is abbreviated as aac(3)Iv.

References

• Ref 1: Mechanisms of resistance in multiple-antibiotic-resistant Escherichia coli strains of human, animal, and food origins. Antimicrob Agents Chemother. 2004 Oct;48(10):3996-4001. doi: 10.1128/AAC.48.10.3996-4001.2004.
• Ref 2: Analysis of a bacterial hygromycin B resistance gene by transcriptional and translational fusions and by DNA sequencing. Nucleic Acids Res. 1983 Oct 11;11(19):6895-911. doi: 10.1093/nar/11.19.6895.