Molecule Information

General Information of the Molecule (ID: Mol00796)

Name	Aminoglycoside N(3)-acetyltransferase (A3AC) ,Enterobacter cloacae
Molecule Type	Protein
Gene Name	aac
Sequence	MTDPRKNGDLHEPATAPATPWSKSELVRQLRDLGVRSGDMVMPHVSLRAVGPLADGPQTL VDALIEAVGPTGNILAFVSWRDSPYEQTLGHDAPPAAIAQSWPAFDPDHAPAYPGFGAIN EFIRTYPGCRRTAHPDASMAAIGPDAAWLVAPHEMGAAYGPRSPIARFLAHAGKILSIGA GPDAVTALHYAEAVARIEGKRRVTYSMPLLREGKRVWVTTSDWDSNGILDEYAAPDGPDA VERIARDYLARTRVAQGPVGGAQSRLIDAADIVSFGIEWLEARHAAPAAAALKPKQRRD Click to Show/Hide
Function	Resistance to antibiotics containing the 2-deoxy-streptamine ring including gentamicin, kanamycin, tobramycin, neomycin and apramycin. Click to Show/Hide
Uniprot ID	Q47030_ENTCL
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Enterobacter Species: Enterobacter cloacae

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Gentamicin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Gentamicin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli strain DH5a		668369
	Enterobacter cloacae strain 88020217		550
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Broth microdilution method assay
Mechanism Description	The resistance profile conferred by the AAC(3)-VIa enzyme,which encodes this novel 3-N-acetyltransferase,includes high-level resistance to gentamicin,sisomicin, and 6'-N-ethylnetilmicin and moderate levels of resistance to tobramycin and netilmicin.

References

Ref 1	blaCMY-2-positive IncA/C plasmids from Escherichia coli and Salmonella enterica are a distinct component of a larger lineage of plasmids. Antimicrob Agents Chemother. 2010 Feb;54(2):590-6. doi: 10.1128/AAC.00055-09. Epub 2009 Nov 30.
Ref 2	Analysis of the aac(3)-VIa gene encoding a novel 3-N-acetyltransferase. Antimicrob Agents Chemother. 1993 Oct;37(10):2074-9. doi: 10.1128/AAC.37.10.2074.