Molecule Information

General Information of the Molecule (ID: Mol00784)

• Name: Aminoglycoside 3'-phosphotransferase (A3AP) ,Campylobacter jejuni
• Synonyms: APH(3')VII; Kanamycin kinase; type VII; Neomycin-kanamycin phosphotransferase type VII
• Molecule Type: Protein
• Gene Name: aphA-7
• Sequence:
  MKYIDEIQILGKCSEGMSPAEVYKCQLKNTVCYLKKIDDIFSKTTYSVKREAEMMMWLSD
  KLKVPDVIEYGVREHSEYLIMSELRGKHIDCFIDHPIKYIECLVNALHQLQAIDIRNCPF
  SSKIDVRLKELKYLLDNRIADIDVSNWEDTTEFDDPMTLYQWLCENQPQEELCLSHGDMS
  ANFFVSHDGIYFYDLARCGVADKWLDIAFCVREIREYYPDSDYEKFFFNMLGLEPDYKKI
  NYYILLDEMF
• Function: Resistance to kanamycin and structurally-related aminoglycosides, including amikacin.
• Uniprot ID: KKA7_CAMJU

Kingdom: N.A.
Phylum: Proteobacteria
Class: Epsilonproteobacteria
Order: Campylobacterales
Family: Campylobacteraceae
Genus: Campylobacter
Species: Campylobacter jejuni

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Kanamycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Campylobacter fetus infection [1]

• Resistant Disease: Campylobacter fetus infection [ICD-11: 1C40.0]
• Resistant Drug: Kanamycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Campylobacter jejuni; 197
• In Vitro Model: Escherichia coli strain JC2926 C600; 562
• Experiment for Molecule Alteration: Dideoxy method assay
• Experiment for Drug Resistance: Disk diffusion method assay
• Mechanism Description: A novel kanamycin phosphotransferase gene, aphA-7, was cloned from a 14-kb plasmid obtained from a strain of Campylobacter jejuni and the nucleotide sequence of the gene was determined. The presumed open reading frame of the aphA-7 structural gene was 753 bp in length and encoded a protein of 251 amino acids with a calculated weight of 29,691 Da.

Disease Class: Escherichia coli infection [1]

• Resistant Disease: Escherichia coli infection [ICD-11: 1A03.0]
• Resistant Drug: Kanamycin
• Molecule Alteration: Expression; Acquired
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Campylobacter jejuni; 197
• In Vitro Model: Escherichia coli strain JC2926 C600; 562
• Experiment for Molecule Alteration: Dideoxy method assay
• Experiment for Drug Resistance: Disk diffusion method assay
• Mechanism Description: A novel kanamycin phosphotransferase gene, aphA-7, was cloned from a 14-kb plasmid obtained from a strain of Campylobacter jejuni and the nucleotide sequence of the gene was determined. The presumed open reading frame of the aphA-7 structural gene was 753 bp in length and encoded a protein of 251 amino acids with a calculated weight of 29,691 Da.

References

• Ref 1: Nucleotide sequence of a novel kanamycin resistance gene, aphA-7, from Campylobacter jejuni and comparison to other kanamycin phosphotransferase genes. Plasmid. 1989 Jul;22(1):52-8. doi: 10.1016/0147-619x(89)90035-8.