Molecule Information

General Information of the Molecule (ID: Mol00773)

• Name: Aminoglycoside (3'') (9) adenylyltransferase (AADA) ,Salmonella enterica serovar Typhimurium
• Molecule Type: Protein
• Gene Name: aadA21
• Sequence:
  MRVAVTIEISNQLSEVLSVIERHLESTLLAVHLYGSAVDGGLKPYSDIDLLVTVTVRLDE
  TTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAKRELQFGEWQRNDILAG
  IFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLFEALNETLTLWNSPPDWA
  GDERNVVLTLSRIWYSAVTGKIAPKDVARDWAMERLPAQYQPVILEARQAYLGQEEDRLA
  SRADQLEEFVHYVKGEITKVVGK
• Uniprot ID: Q8GCH1_SALTM

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Salmonella
Species: Salmonella enterica subsp. enterica serovar Typhimurium

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Spectinomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Salmonella enterica infection [1]

• Resistant Disease: Salmonella enterica infection [ICD-11: 1A09.0]
• Resistant Drug: Spectinomycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Salmonella enterica serovar typhimurium strain; 90371
• Experiment for Molecule Alteration: PCR
• Experiment for Drug Resistance: Disk diffusion method assay
• Mechanism Description: Besides the genes present in the multidrug-resistant Salmonella serovar Typhimurium strains, other genes related to antibiotic resistance were described in Salmonella serovar Typhimurium or other closely related species. Tetracycline resistance could also be encoded by tetA, tetB, tetC or aadA21.

Streptomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Salmonella enterica infection [1]

• Resistant Disease: Salmonella enterica infection [ICD-11: 1A09.0]
• Resistant Drug: Streptomycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Salmonella enterica serovar typhimurium strain; 90371
• Experiment for Molecule Alteration: PCR
• Experiment for Drug Resistance: Disk diffusion method assay
• Mechanism Description: Besides the genes present in the multidrug-resistant Salmonella serovar Typhimurium strains, other genes related to antibiotic resistance were described in Salmonella serovar Typhimurium or other closely related species. Tetracycline resistance could also be encoded by tetA, tetB, tetC or aadA21.

References

• Ref 1: Evolution of antibiotic resistance in Salmonella enterica serovar typhimurium strains isolated in the Czech Republic between 1984 and 2002. Antimicrob Agents Chemother. 2003 Jun;47(6):2002-5. doi: 10.1128/AAC.47.6.2002-2005.2003.