Molecule Information

General Information of the Molecule (ID: Mol00765)

• Name: ABC transporter ATP-binding/permease protein YojI (YOJI) ,Escherichia coli
• Synonyms: yojJ; b2211; JW2199
• Molecule Type: Protein
• Gene Name: yojI
• Gene ID: 946705
• Sequence:
  MELLVLVWRQYRWPFISVMALSLASAALGIGLIAFINQRLIETADTSLLVLPEFLGLLLL
  LMAVTLGSQLALTTLGHHFVYRLRSEFIKRILDTHVERIEQLGSASLLAGLTSDVRNITI
  AFVRLPELVQGIILTIGSAAYLWMLSGKMLLVTAIWMAITIWGGFVLVARVYKHMATLRE
  TEDKLYTDFQTVLEGRKELTLNRERAEYVFNNLYIPDAQEYRHHIIRADTFHLSAVNWSN
  IMMLGAIGLVFWMANSLGWADTNVAATYSLTLLFLRTPLLSAVGALPTLLTAQVAFNKLN
  KFALAPFKAEFPRPQAFPNWQTLELRNVTFAYQDNAFSVGPINLTIKRGELLFLIGGNGS
  GKSTLAMLLTGLYQPQSGEILLDGKPVSGEQPEDYRKLFSAVFTDVWLFDQLLGPEGKPA
  NPQLVEKWLAQLKMAHKLELSNGRIVNLKLSKGQKKRVALLLALAEERDIILLDEWAADQ
  DPHFRREFYQVLLPLMQEMGKTIFAISHDDHYFIHADRLLEMRNGQLSELTGEERDAASR
  DAVARTA
• Function: Mediates resistance to the antibacterial peptide microcin J25, when expressed from a multicopy vector. Functions as an efflux pump for microcin J25, with the help of the outer membrane channel TolC.
• Uniprot ID: YOJI_ECOLI

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Investigative Drug(s) 1 drug(s) in total

Microcin J25

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Escherichia coli infection [1]

• Resistant Disease: Escherichia coli infection [ICD-11: 1A03.0]
• Resistant Drug: Microcin J25
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli k-12; 83333
• Experiment for Molecule Alteration: Promega and one-step chromosomal gene inactivation method assay
• Experiment for Drug Resistance: Spot-on-lawn assay
• Mechanism Description: YojI, an Escherichia coli open reading frame with an unknown function, mediates resistance to the peptide antibiotic microcin J25 when it is expressed from a multicopy vector. Disruption of the single chromosomal copy of yojI increased sensitivity of cells to microcin J25. One obvious explanation for the protective effect against microcin J25 is that YojI action keeps the intracellular concentration of the peptide below a toxic level. the resistance to MccJ25 mediated by YojI involves extrusion of the peptide and that YojI is assisted by the multifunctional outer membrane protein TolC.

Disease Class: Salmonella enterica infection [1]

• Resistant Disease: Salmonella enterica infection [ICD-11: 1A09.0]
• Resistant Drug: Microcin J25
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli k-12; 83333
• Experiment for Molecule Alteration: Promega and one-step chromosomal gene inactivation method assay
• Experiment for Drug Resistance: Spot-on-lawn assay
• Mechanism Description: YojI, an Escherichia coli open reading frame with an unknown function, mediates resistance to the peptide antibiotic microcin J25 when it is expressed from a multicopy vector. Disruption of the single chromosomal copy of yojI increased sensitivity of cells to microcin J25. One obvious explanation for the protective effect against microcin J25 is that YojI action keeps the intracellular concentration of the peptide below a toxic level. the resistance to MccJ25 mediated by YojI involves extrusion of the peptide and that YojI is assisted by the multifunctional outer membrane protein TolC.

Disease Class: Shigella intestinal infection [1]

• Resistant Disease: Shigella intestinal infection [ICD-11: 1A02.0]
• Resistant Drug: Microcin J25
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli k-12; 83333
• Experiment for Molecule Alteration: Promega and one-step chromosomal gene inactivation method assay
• Experiment for Drug Resistance: Spot-on-lawn assay
• Mechanism Description: YojI, an Escherichia coli open reading frame with an unknown function, mediates resistance to the peptide antibiotic microcin J25 when it is expressed from a multicopy vector. Disruption of the single chromosomal copy of yojI increased sensitivity of cells to microcin J25. One obvious explanation for the protective effect against microcin J25 is that YojI action keeps the intracellular concentration of the peptide below a toxic level. the resistance to MccJ25 mediated by YojI involves extrusion of the peptide and that YojI is assisted by the multifunctional outer membrane protein TolC.

References

• Ref 1: YojI of Escherichia coli functions as a microcin J25 efflux pump. J Bacteriol. 2005 May;187(10):3465-70. doi: 10.1128/JB.187.10.3465-3470.2005.