Molecule Information

General Information of the Molecule (ID: Mol00763)

• Name: ABC transporter ATPase subunit (ABCS) ,Streptococcus pneumoniae
• Synonyms: mel; yheS_2; yheS_3; ERS022181_01535; SAMEA3390019_00884; SAMEA3714416_01732; Mel; Mel efflux pump protein; Mel protein; Putative integrative and conjugative element protein; Ribose import ATP-binding protein rbsA; EC 3.6.3.17
• Molecule Type: Protein
• Gene Name: mel
• Gene ID: 61401270
• Sequence:
  MELILKAKDIRVEFKGRDVLDINELEVYDYDRIGLVGANGAGKSTLLRVLLGELTPPGCK
  MNRLGELAYIPQLDEVTLQEEKDFALVGKLGVEQLNIQTMSGGEETRLKIAQALSAQVHG
  ILADEPTSHLDREGIDFLIGQLKYFTGALLVISHDRYFLDEIVDKIWELKDGKITEYWGN
  YSDYLRQKEEERKSQAAEYEQFIAERARLERAAEEKRKQARKIEQKAKGSSKKKSTEDGG
  RLAHQKSIGSKEKKMYNAAKTLEHRIAALGKVEAPEGIRRIRFRQSKALELHNPYPIVGA
  EINKVFGDKALFENASFQIPLGAKVALTGGNGIGKTTLIQMILNHEEGISISPKAKIGYF
  AQNGYKYNSNQNVMEFMQKDCDYNISEIRSVLASMGFKQNDIGKSLSVLSGGEIIKLLLA
  KMLMGRYNILIMDEPSNFLDIPSLEALEILMKEYTGTIVFITHDKRLLENVADVVYEIRD
  KKINLKH
• Uniprot ID: Q93QE4_STREE

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Streptococcaceae
Genus: Streptococcus
Species: Streptococcus pneumoniae

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Ampicillin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Bacterial infection [1], [2], [3]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Ampicillin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Enterococcus faecalis isolates; 1351
• Experiment for Molecule Alteration: Whole genome sequence assay
• Experiment for Drug Resistance: Broth microdilution method assay
• Mechanism Description: Multidrug efflux pump extraction, purification, and sequencing showed the distribution of mefA and msrA/msrB efflux pumps.

Erythromycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Bacterial infection [1], [2], [3]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Erythromycin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Enterococcus faecalis isolates; 1351
• Experiment for Molecule Alteration: Whole genome sequence assay
• Experiment for Drug Resistance: Broth microdilution method assay
• Mechanism Description: Multidrug efflux pump extraction, purification, and sequencing showed the distribution of mefA and msrA/msrB efflux pumps.

References

• Ref 1: Macrolide efflux in Streptococcus pneumoniae is mediated by a dual efflux pump (mel and mef) and is erythromycin inducible. Antimicrob Agents Chemother. 2005 Oct;49(10):4203-9. doi: 10.1128/AAC.49.10.4203-4209.2005.
• Ref 2: First report of mefA and msrA/msrB multidrug efflux pumps associated with blaTEM-1 Beta-lactamase in Enterococcus faecalis. Int J Infect Dis. 2012 Feb;16(2):e104-9. doi: 10.1016/j.ijid.2011.09.024. Epub 2011 Dec 1.
• Ref 3: Comparative genomics of IncL/M-type plasmids: evolution by acquisition of resistance genes and insertion sequences. Antimicrob Agents Chemother. 2013 Jan;57(1):674-6. doi: 10.1128/AAC.01086-12. Epub 2012 Oct 31.