Molecule Information

General Information of the Molecule (ID: Mol00760)

• Name: ABC superfamily ATP binding cassette transporter (ABCCT) ,Staphylococcus sciuri
• Synonyms: sal(A); ABC superfamily ATP binding cassette transporter
• Molecule Type: Protein
• Gene Name: sal(A)
• Sequence:
  MLFLFEEKALEVEHKVLIPELTFSIEDHEHLAIVGVNGVGKSTLLKVIHQDQSVDSAMME
  QDLTPYYDWTVMDYIIESYPEIAKIRLQLNHTDMINKYIELDGYIIEGEIVTEAKKLGIK
  EEQLEQKISTLSGGEQTKVSFLKVKMSKASLLLIDEPTNHMDLEMKEWLTKAFKQEQRAI
  LFVSHDRTFLNETPDAILELSLDGAKKYIGKYDKYKQQKDIEHETLKLQYEKQQKEQAAI
  EETIKKYKAWYQKAEQSASVRSPYQQKQLSKLAKRFKSKEQQLNRKLDQEHIPNPHKKEK
  TFSIQHHNFKSHYLVQFNHVSFAYDNRKIFDDVSFYIKRNQNVIVEGRNGTGKSTLIKLI
  LGELEPTKGDITVHPELEIGYFSQDFENLNMHHTVLDEILEIPEMKEADARTILASFYFD
  KDRINDVVETLSMGEKCRLQFVKLYFSNPHIMILDEPTNYFDIGMQENIIQLIQSFQGSV
  LIVSHDNYFKSQIKDQTWTIKNHQMTHENVQVKDPINTESMKHHLKELEQYTDERNRETE
  F
• Uniprot ID: T1RRK4_MAMSC

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Bacillales
Family: Staphylococcaceae
Genus: Mammaliicoccus
Species: Mammaliicoccus sciuri

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Lincomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Bacterial infection [1], [2]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Lincomycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli TOP10; 83333
• In Vitro Model: Staphylococcus aureus RN4220; 1280
• In Vitro Model: Staphylococcus saprophyticus ATCC 15305; 342451
• In Vitro Model: Staphylococcus sciuri ATCC 29059; 1296
• In Vitro Model: Staphylococcus sciuri ATCC 29062; 1296
• In Vitro Model: Staphylococcus sciuri ATCC 700058; 1296
• In Vitro Model: Staphylococcus sciuri ATCC 700061; 1296
• In Vitro Model: Staphylococcus sciuri BL2; 1296
• In Vitro Model: Staphylococcus sciuri SS226; 1296
• In Vitro Model: Staphylococcus sciuri SVv1; 1296
• Experiment for Molecule Alteration: Whole genome sequence assay
• Experiment for Drug Resistance: Disk diffusion test assay; E-strip test assay
• Mechanism Description: Efflux-mediated resistance to MLS antibiotics in staphylococci relies on the ATPase activity of a very special kind of ATP-binding cassette (ABC) protein.By whole-genome sequencing of strain ATCC 29059, we identified a candidate gene that encodes an ATP-binding cassette protein similar to the Lsa and VmlR resistance determinants. Isolation and reverse transcription-quantitative PCR (qRT-PCR) expression studies confirmed that Sal(A) can confer a moderate resistance to lincosamides (8 times the MIC of lincomycin) and a high-level resistance to streptogramins A. The chromosomal location of sal(A) between two housekeeping genes of the staphylococcal core genome supports the gene's ancient origins and thus innate resistance to these antimicrobials within S. sciuri subspecies.

Investigative Drug(s) 1 drug(s) in total

Pristinamycin IIA

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Bacterial infection [1], [2]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Pristinamycin IIA
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli TOP10; 83333
• In Vitro Model: Staphylococcus aureus RN4220; 1280
• In Vitro Model: Staphylococcus saprophyticus ATCC 15305; 342451
• In Vitro Model: Staphylococcus sciuri ATCC 29059; 1296
• In Vitro Model: Staphylococcus sciuri ATCC 29062; 1296
• In Vitro Model: Staphylococcus sciuri ATCC 700058; 1296
• In Vitro Model: Staphylococcus sciuri ATCC 700061; 1296
• In Vitro Model: Staphylococcus sciuri BL2; 1296
• In Vitro Model: Staphylococcus sciuri SS226; 1296
• In Vitro Model: Staphylococcus sciuri SVv1; 1296
• Experiment for Molecule Alteration: Whole genome sequence assay
• Experiment for Drug Resistance: Disk diffusion test assay; E-strip test assay
• Mechanism Description: Efflux-mediated resistance to MLS antibiotics in staphylococci relies on the ATPase activity of a very special kind of ATP-binding cassette (ABC) protein.By whole-genome sequencing of strain ATCC 29059, we identified a candidate gene that encodes an ATP-binding cassette protein similar to the Lsa and VmlR resistance determinants. Isolation and reverse transcription-quantitative PCR (qRT-PCR) expression studies confirmed that Sal(A) can confer a moderate resistance to lincosamides (8 times the MIC of lincomycin) and a high-level resistance to streptogramins A. The chromosomal location of sal(A) between two housekeeping genes of the staphylococcal core genome supports the gene's ancient origins and thus innate resistance to these antimicrobials within S. sciuri subspecies.

References

• Ref 1: Characterization of sal(A), a novel gene responsible for lincosamide and streptogramin A resistance in Staphylococcus sciuri. Antimicrob Agents Chemother. 2014 Jun;58(6):3335-41. doi: 10.1128/AAC.02797-13. Epub 2014 Mar 31.
• Ref 2: Identification of ABC transporter genes conferring combined pleuromutilin-lincosamide-streptogramin A resistance in bovine methicillin-resistant Staphylococcus aureus and coagulase-negative staphylococci. Vet Microbiol. 2015 Jun 12;177(3-4):353-8. doi: 10.1016/j.vetmic.2015.03.027. Epub 2015 Apr 8.