Molecule Information

General Information of the Molecule (ID: Mol00743)

Name	Protein QacZ (QACZ) ,Enterococcus faecium
Synonyms	qacZ; QacZ Click to Show/Hide
Molecule Type	Protein
Gene Name	qacZ
Sequence	MPYLYLLLAIVSEVIGSAFLKSSDGFSKLYPTITTIISYLISFYFLSKTMQHLPLNIAYA SWSGLGLVLTTIVSVLIFKEQINLISIISIILIIFGVVLLNTFGSSH Click to Show/Hide
Uniprot ID	A0A088SHQ9_ENTFC
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Firmicutes Class: Bacilli Order: Lactobacillales Family: Enterococcaceae Genus: Enterococcus Species: Enterococcus faecalis

Type(s) of Resistant Mechanism of This Molecule

IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Benzalkonium chloride

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Enterococcal infection			[1]
Resistant Disease	Enterococcal infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Benzalkonium chloride		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Enterococcus faecalis EF-SAVE1		1244142
	Enterococcus faecalis V583ErmS		1244142
Experiment for Molecule Alteration	RT-PCR
Experiment for Drug Resistance	MIC determination assay
Mechanism Description	A derivative strain of V583, susceptible to erythromycin (V583ErmS), was complemented with pORI23 carrying the qacZ gene (strain EF-SAVE1). MICs of benzalkonium chloride, chlorhexidine and ethidium bromide were determined for the complemented strain and wild-type. The complemented strain, EF-SAVE1, presented a higher MIC of benzalkonium chloride (8 mg/L) than V583ErmS (4 mg/L); the MICs of chlorhexidine and ethidium bromide were the same for both strains, 4 mg/L and 16 mg/L, respectively. Expression of qacZ was found to be higher in EF-SAVE1 and constitutive, i.e. not inducible by any of the three tested bi.

References

Ref 1	Involvement, and dissemination, of the enterococcal small multidrug resistance transporter QacZ in resistance to quaternary ammonium compounds. J Antimicrob Chemother. 2011 Feb;66(2):283-6. doi: 10.1093/jac/dkq460. Epub 2010 Dec 8.