Molecule Information

General Information of the Molecule (ID: Mol00730)

Name	Protein pexA (PEXA) ,Escherichia coli
Synonyms	pexA; AKSOIL_0345; PexA Click to Show/Hide
Molecule Type	Protein
Gene Name	pexA
Sequence	MKKFVLFCERNGIALIPIVLILLGCGLWPEMELLVPSLPDMQRAFNIQDAQIQQLLTANF VGFLIGVLFAGPLCDSAGRRTVMMIGTIGYLVSSVLCPFCNDFVLLMIARFFQGLFMTGP VIAGGVLLMEATEGVKQIFWMSIGNAAITFCMAAGPIVGSWINTGFGYVGNLWSILILGL IGCLPALFLVPESLPVEKRAAFHPKLLFKGYFALLKDFRFMCLAIPMCALAAAYWIYVGV SALYMVNQLGIAQEMFGRYQGPIVGCFSIISLGSSKLLQRFGLMKCLRAGIVSMFTGMLL LLGMSILSLDHAVATTVFMMFFVGGMAPICSMLFPYALGHLPVDLKGNAQAMVQAIRLFF ASIGTSLVGVFYKSAFLPVALIMFAILLFSCYFLWKGRRYLKEGLGADHILSVGH Click to Show/Hide
Uniprot ID	D9MX76_9BACT
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Escherichia Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s)

2 drug(s) in total

Click to Show/Hide the Full List of Drugs

Chloramphenicol

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Chloramphenicol		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli		668369
Experiment for Molecule Alteration	Nucleotide sequence assay
Experiment for Drug Resistance	Broth microdilution assay
Mechanism Description	In its natural host, pexA could provide protection against chloramphenicol and florfenicol excreted by Streptomyces spp.

Florfenicol

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Florfenicol		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli		668369
Experiment for Molecule Alteration	Nucleotide sequence assay
Experiment for Drug Resistance	Broth microdilution assay
Mechanism Description	In its natural host, pexA could provide protection against chloramphenicol and florfenicol excreted by Streptomyces spp.

References

Ref 1	Novel florfenicol and chloramphenicol resistance gene discovered in Alaskan soil by using functional metagenomics. Appl Environ Microbiol. 2010 Aug;76(15):5321-6. doi: 10.1128/AEM.00323-10. Epub 2010 Jun 11.