Molecule Information

General Information of the Molecule (ID: Mol00529)

Name	Nuclear transcription factor Y subunit beta (NFYB) ,Homo sapiens
Synonyms	CAAT box DNA-binding protein subunit B; Nuclear transcription factor Y subunit B; NF-YB; HAP3 Click to Show/Hide
Molecule Type	Protein
Gene Name	NFYB
Gene ID	4801
Location	chr12:104117086-104138241[-]
Sequence	MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLP IANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLIT TDGQQQNVMVYTTSYQQISGVQQIQFS Click to Show/Hide
Function	Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors. Click to Show/Hide
Uniprot ID	NFYB_HUMAN
Ensembl ID	ENSG00000120837
HGNC ID	HGNC:7805
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

2 drug(s) in total

Click to Show/Hide the Full List of Drugs

Doxorubicin

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Lymphocytic leukemia				[1]
Sensitive Disease	Lymphocytic leukemia [ICD-11: 2B33.2]			Disease Info
Sensitive Drug	Doxorubicin			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Revealed Based on the Cell Line Data
In Vitro Model	CEM cells	Pleural effusion	Homo sapiens (Human)	N.A.
	CEM/VM-1-5 cells	Lymph	Homo sapiens (Human)	CVCL_1B35
Experiment for Molecule Alteration	Western blotting analysis
Experiment for Drug Resistance	MTT assay
Mechanism Description	miR-485-3p expression can mediate etoposide sensitivity indirectly by fine-tuning Top2alpha expression through the modification of NF-YB expression. Accordingly, miR-485-3p can be a putative therapeutic target to modulate etoposide resistance in tumor cells.

Etoposide

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Lymphocytic leukemia				[1]
Sensitive Disease	Lymphocytic leukemia [ICD-11: 2B33.2]			Disease Info
Sensitive Drug	Etoposide			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Revealed Based on the Cell Line Data
In Vitro Model	CEM cells	Pleural effusion	Homo sapiens (Human)	N.A.
	CEM/VM-1-5 cells	Lymph	Homo sapiens (Human)	CVCL_1B35
Experiment for Molecule Alteration	Western blotting analysis
Experiment for Drug Resistance	MTT assay
Mechanism Description	miR-485-3p expression can mediate etoposide sensitivity indirectly by fine-tuning Top2alpha expression through the modification of NF-YB expression. Accordingly, miR-485-3p can be a putative therapeutic target to modulate etoposide resistance in tumor cells.

References

Ref 1	Novel regulation of nuclear factor-YB by miR-485-3p affects the expression of DNA topoisomerase IIAlpha and drug responsiveness. Mol Pharmacol. 2011 Apr;79(4):735-41. doi: 10.1124/mol.110.069633. Epub 2011 Jan 20.