Molecule Information

General Information of the Molecule (ID: Mol00451)

Name	Adenylate kinase 4 (AK4) ,Homo sapiens
Synonyms	AK 4; Adenylate kinase 3-like; GTP:AMP phosphotransferase AK4; AK3; AK3L1 Click to Show/Hide
Molecule Type	Protein
Gene Name	AK4
Gene ID	205
Location	chr1:65147549-65232145[+]
Sequence	MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEK SLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLK DRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKP VIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY Click to Show/Hide
Function	Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Efficiently phosphorylates AMP and dAMP using ATP as phosphate donor, but phosphorylates only AMP when using GTP as phosphate donor. Also displays broad nucleoside diphosphate kinase activity. Plays a role in controlling cellular ATP levels by regulating phosphorylation and activation of the energy sensor protein kinase AMPK. Plays a protective role in the cellular response to oxidative stress. Click to Show/Hide
Uniprot ID	KAD4_HUMAN
Ensembl ID	ENSG00000162433
HGNC ID	HGNC:363
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

3 drug(s) in total

Click to Show/Hide the Full List of Drugs

Carboplatin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Osteosarcoma				[1]
Resistant Disease	Osteosarcoma [ICD-11: 2B51.0]			Disease Info
Resistant Drug	Carboplatin			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Revealed Based on the Cell Line Data
Cell Pathway Regulation	Cell viability		Activation	hsa05200
	NF-kappaB signaling pathway		Inhibition	hsa04064
In Vitro Model	U2OS cells	Bone	Homo sapiens (Human)	CVCL_0042
	G-292 cells	Bone	Homo sapiens (Human)	CVCL_2909
	MNNG/HOS cells	Bone	Homo sapiens (Human)	CVCL_0439
In Vivo Model	Nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Western blot analysis; RIP assay; Luciferase reporter assay
Experiment for Drug Resistance	CCK8 assay
Mechanism Description	The Ak4 gene is one of the targets of miR-199a-3p and negatively correlates with the effect of miR-199a-3p on OS drug-resistance.

Cisplatin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Osteosarcoma				[1]
Resistant Disease	Osteosarcoma [ICD-11: 2B51.0]			Disease Info
Resistant Drug	Cisplatin			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Revealed Based on the Cell Line Data
Cell Pathway Regulation	Cell viability		Activation	hsa05200
	NF-kappaB signaling pathway		Inhibition	hsa04064
In Vitro Model	U2OS cells	Bone	Homo sapiens (Human)	CVCL_0042
	G-292 cells	Bone	Homo sapiens (Human)	CVCL_2909
	MNNG/HOS cells	Bone	Homo sapiens (Human)	CVCL_0439
In Vivo Model	Nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Western blot analysis; RIP assay; Luciferase reporter assay
Experiment for Drug Resistance	CCK8 assay
Mechanism Description	The Ak4 gene is one of the targets of miR-199a-3p and negatively correlates with the effect of miR-199a-3p on OS drug-resistance.

Doxorubicin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Osteosarcoma				[1]
Resistant Disease	Osteosarcoma [ICD-11: 2B51.0]			Disease Info
Resistant Drug	Doxorubicin			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Revealed Based on the Cell Line Data
Cell Pathway Regulation	Cell viability		Activation	hsa05200
	NF-kappaB signaling pathway		Inhibition	hsa04064
In Vitro Model	U2OS cells	Bone	Homo sapiens (Human)	CVCL_0042
	G-292 cells	Bone	Homo sapiens (Human)	CVCL_2909
	MNNG/HOS cells	Bone	Homo sapiens (Human)	CVCL_0439
In Vivo Model	Nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Western blot analysis; RIP assay; Luciferase reporter assay
Experiment for Drug Resistance	CCK8 assay
Mechanism Description	The Ak4 gene is one of the targets of miR-199a-3p and negatively correlates with the effect of miR-199a-3p on OS drug-resistance.

References

Ref 1	MiR-199a-3p affects the multi-chemoresistance of osteosarcoma through targeting AK4. BMC Cancer. 2018 Jun 4;18(1):631. doi: 10.1186/s12885-018-4460-0.