Molecule Information
General Information of the Molecule (ID: Mol00431)
Name |
DNA-binding protein Ikaros (IKZF1)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Ikaros family zinc finger protein 1; Lymphoid transcription factor LyF-1; IK1; IKAROS; LYF1; ZNFN1A1
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
IKZF1
|
||||
Gene ID | |||||
Location |
chr7:50304068-50405101[+]
|
||||
Sequence |
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVE
TQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCD ICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNY ACRRRDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGTLYPVI KEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYE KENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPMYQLHKPLAEGTPR SNHSAQDSAVENLLLLSKAKLVPSEREASPSNSCQDSTDTESNNEEQRSGLIYLTNHIAP HARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKCEHCRVLFLDHVMYTIH MGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRFHMS Click to Show/Hide
|
||||
Function |
Transcription regulator of hematopoietic cell differentiation. Binds gamma-satellite DNA. Plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. Regulates transcription through association with both HDAC-dependent and HDAC-independent complexes. Targets the 2 chromatin-remodeling complexes, NuRD and BAF (SWI/SNF), in a single complex (PYR complex), to the beta-globin locus in adult erythrocytes. Increases normal apoptosis in adult erythroid cells. Confers early temporal competence to retinal progenitor cells (RPCs). Function is isoform-specific and is modulated by dominant-negative inactive isoforms.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Lenalidomide
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Unusual Activation of Pro-survival Pathway (UAPP) | ||||
Disease Class: Multiple myeloma | [1] | |||
Resistant Disease | Multiple myeloma [ICD-11: 2A83.0] | |||
Resistant Drug | Lenalidomide | |||
Molecule Alteration | Mutation | . |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell proliferation | Activation | hsa05200 | |
PI3K/RAS signaling pathway | Regulation | hsa04151 | ||
In Vitro Model | Bone marrow | Blood | Homo sapiens (Human) | N.A. |
In Vivo Model | A retrospective survey in conducting clinical studies | Homo sapiens | ||
Experiment for Molecule Alteration |
Gene expression profiling assay; High-resolution copy number arrays assay; Whole-exome sequencing assay | |||
Experiment for Drug Resistance |
Longitudinal copy number aberration (CNA) analysis | |||
Mechanism Description | Resistance to immunomodulatory drugs (IMiD) and proteasome inhibitors was recently associated with mutations in IMiD response genes IRF4, CRBN, DDB1, CUL4A, CUL4B, IkZF1, IkZF2, and IkZF3 or in the proteasome inhibitor response genes PSMB5 and PSMG2, respectively. Mechanistically, bi-allelic loss of tumor-suppressor genes is a crucial mechanism, allowing units of selection to evade treatment-induced apoptosis with the acquisition of subsequent proliferative advantage leading to their outgrowth. |
Thalidomide
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Unusual Activation of Pro-survival Pathway (UAPP) | ||||
Disease Class: Multiple myeloma | [1] | |||
Resistant Disease | Multiple myeloma [ICD-11: 2A83.0] | |||
Resistant Drug | Thalidomide | |||
Molecule Alteration | Mutation | . |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell proliferation | Activation | hsa05200 | |
PI3K/RAS signaling pathway | Regulation | hsa04151 | ||
In Vitro Model | Bone marrow | Blood | Homo sapiens (Human) | N.A. |
In Vivo Model | A retrospective survey in conducting clinical studies | Homo sapiens | ||
Experiment for Molecule Alteration |
Gene expression profiling assay; High-resolution copy number arrays assay; Whole-exome sequencing assay | |||
Experiment for Drug Resistance |
Longitudinal copy number aberration (CNA) analysis | |||
Mechanism Description | Resistance to immunomodulatory drugs (IMiD) and proteasome inhibitors was recently associated with mutations in IMiD response genes IRF4, CRBN, DDB1, CUL4A, CUL4B, IkZF1, IkZF2, and IkZF3 or in the proteasome inhibitor response genes PSMB5 and PSMG2, respectively. Mechanistically, bi-allelic loss of tumor-suppressor genes is a crucial mechanism, allowing units of selection to evade treatment-induced apoptosis with the acquisition of subsequent proliferative advantage leading to their outgrowth. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Multiple myeloma [ICD-11: 2A83]
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Bone marrow | |
The Specified Disease | Multiple myeloma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.21E-02; Fold-change: 1.74E-01; Z-score: 5.04E-01 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Peripheral blood | |
The Specified Disease | Multiple myeloma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 7.75E-01; Fold-change: -4.95E-02; Z-score: -1.49E-01 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances | Click to View the Clearer Original Diagram | |
Tissue-specific Molecule Abundances in Healthy Individuals
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.