Molecule Information

General Information of the Molecule (ID: Mol00108)

• Name: Melanoma-associated antigen 6 (MAGEA6) ,Homo sapiens
• Synonyms: Cancer/testis antigen 1.6; CT1.6; MAGE-6 antigen; MAGE3B antigen; MAGE6
• Molecule Type: Protein
• Gene Name: MAGEA6
• Gene ID: 4105
• Location: chrX:152766136-152769716[-]
• Sequence:
  MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPD
  PPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAKLVHFL
  LLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASDSLQLVFGIELMEVDPIGHVYIFAT
  CLGLSYDGLLGDNQIMPKTGFLIIILAIIAKEGDCAPEEKIWEELSVLEVFEGREDSIFG
  DPKKLLTQYFVQENYLEYRQVPGSDPACYEFLWGPRALIETSYVKVLHHMVKISGGPRIS
  YPLLHEWALREGEE
• Function: Activator of ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases that acts as a as repressor of autophagy. May enhance ubiquitin ligase activity of TRIM28 and stimulate p53/TP53 ubiquitination by TRIM28. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. May play a role in tumor transformation or aspects of tumor progression. In vitro promotes cell viability in melanoma cell lines.
• Uniprot ID: MAGA6_HUMAN
• Ensembl ID: ENSG00000197172
• HGNC ID: HGNC:6804

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Cisplatin

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Medulloblastoma [1]

• Sensitive Disease: Medulloblastoma [ICD-11: 2A00.10]
• Sensitive Drug: Cisplatin
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Identified from the Human Clinical Data
• Cell Pathway Regulation: Cell apoptosis; Activation; hsa04210
• Cell Pathway Regulation: p53 signaling pathway; Activation; hsa04115
• In Vitro Model: UW228 cells; Brain; Homo sapiens (Human); CVCL_8585
• In Vitro Model: R262 cells; Bone marrow; Homo sapiens (Human); CVCL_VU83
• In Vitro Model: R300 cells; Bone marrow; Homo sapiens (Human); CVCL_VU84
• In Vitro Model: UW426 cells; Bone marrow; Homo sapiens (Human); CVCL_DH82
• Experiment for Molecule Alteration: Western blotting analysis
• Experiment for Drug Resistance: MTS assay
• Mechanism Description: The repression of MAGE-A by miR-34a results in increased expression of p53 thus lead to resistance.

Mitomycin

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Medulloblastoma [1]

• Sensitive Disease: Medulloblastoma [ICD-11: 2A00.10]
• Sensitive Drug: Mitomycin
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Identified from the Human Clinical Data
• Cell Pathway Regulation: Cell apoptosis; Activation; hsa04210
• Cell Pathway Regulation: p53 signaling pathway; Activation; hsa04115
• In Vitro Model: UW228 cells; Brain; Homo sapiens (Human); CVCL_8585
• In Vitro Model: R262 cells; Bone marrow; Homo sapiens (Human); CVCL_VU83
• In Vitro Model: R300 cells; Bone marrow; Homo sapiens (Human); CVCL_VU84
• In Vitro Model: UW426 cells; Bone marrow; Homo sapiens (Human); CVCL_DH82
• Experiment for Molecule Alteration: Western blotting analysis
• Experiment for Drug Resistance: MTS assay
• Mechanism Description: The repression of MAGE-A by miR-34a results in increased expression of p53 thus lead to resistance.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Brain cancer [ICD-11: 2A00]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Nervous tissue
• The Specified Disease: Brain cancer
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 2.99E-07; Fold-change: -1.05E-02; Z-score: -4.44E-02
• The Studied Tissue: Brainstem tissue
• The Specified Disease: Glioma
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 5.31E-01; Fold-change: -8.95E-03; Z-score: -1.23E-01
• The Studied Tissue: White matter
• The Specified Disease: Glioma
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 7.23E-01; Fold-change: -3.67E-03; Z-score: -1.08E-02
• The Studied Tissue: Brainstem tissue
• The Specified Disease: Neuroectodermal tumor
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 1.03E-02; Fold-change: -3.38E-03; Z-score: -7.05E-03

References

• Ref 1: miR-34a confers chemosensitivity through modulation of MAGE-A and p53 in medulloblastoma. Neuro Oncol. 2011 Feb;13(2):165-75. doi: 10.1093/neuonc/noq179. Epub 2010 Dec 22.