Molecule Information

General Information of the Molecule (ID: Mol03007)

Name	B-lymphocyte antigen CD20 (CD20) ,Homo sapiens
Synonyms	MS4A1; CD20 Click to Show/Hide
Molecule Type	Protein
Gene Name	CD20
Gene ID	931
Location	chr11:60,455,846-60,470,752[+]
Sequence	MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNG LFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMN SLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPST QYCYSIQSLFLGILSVMLIFAFFQELVIAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTI EIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP Click to Show/Hide
Function	B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR. Click to Show/Hide
Uniprot ID	CD20_HUMAN
Ensembl ID	ENSG00000156738
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Rituximab

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: B cell lymphoma			[1]
Resistant Disease	B cell lymphoma [ICD-11: 2A86.1]		Disease Info
Resistant Drug	Rituximab		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
Mechanism Description	Obviously, the CD20 molecule itself can be involved in resistance to Rituximab by loss in protein expression, membrane exposure and structural changes. Reduction or loss of CD20 cell surface expression following Rituximab treatment has been reported in some patients with B-NHL.

References

Ref 1	Molecular mechanisms of resistance to Rituximab and pharmacologic strategies for its circumvention .Leuk Lymphoma. 2009 Jun;50(6):873-85. doi: 10.1080/10428190902878471. 10.1080/10428190902878471