Molecule Information

General Information of the Molecule (ID: Mol02137)

• Name: Miltefosine transporter beta subunit (ROS3) ,Mycobacteroides abscessus
• Synonyms: Miltefosine transporter beta subunit; Ros3
• Molecule Type: Protein
• Gene Name: Ros3
• Sequence:
  MAPLPPKPHSKNRIEQQQLPHIYARHSPLSVSVVFFILAVAAIPIGVLVIVSGDLTTRLD
  FRYDHINSYKFAMGAAGEFAVNFPFNGTMYSSGVKTRLMFSLHQSLTAPVYMQYRLSPFF
  QNYRYFTASVDYSQLSGRASAISKLCAPFRFPGEATGDSVSGYYNPCGAYPWAMFNDSIS
  LYRTDGTLICDGSAFTANGTSLAANNKCVKSGIARPSDVKERYNPPREIPGNGPMWSAGG
  NKSATDPYLREGYYYKEPGHKIPLSIDEDLIVWLDPAFTSDVTKNYRILNVDLPAGDYYF
  EITEQYPTAPYASHKFVQLATRSWIGGRSHVLGSLLIIMGGTAFIMAVTLLSVKYLIMPV
  YTEDI
• Uniprot ID: Q0P0L8_LEIDO

Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Corynebacteriales
Family: Mycobacteriaceae
Genus: Mycobacteroides
Species: Mycobacteroides abscessus

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Miltefosine

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Leishmaniasis [1]

• Resistant Disease: Leishmaniasis [ICD-11: 1F54.1]
• Resistant Drug: Miltefosine
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• Mechanism Description: The uptake of MIL and other alkyl-glycerophospholipids in Leishmania requires a translocation machinery that includes a P-type ATPase named the Leishmania miltefosine transporter (LMT), which is responsible for the translocation of phospholipids from the exoplasmic to the cytoplasmic leaflet of the plasma membrane of Leishmania. The function of LMT depends on its binding to a specific B subunit of LMT called LRos3, which belongs to the CDC50/LEM3 protein family. Both proteins are mutually dependent for their function and their localization at the plasma membrane of Leishmania, being required for MIL uptake and susceptibility.

References

• Ref 1: Drug resistance and treatment failure in leishmaniasis: A 21st century challenge .PLoS Negl Trop Dis. 2017 Dec 14;11(12):e0006052. doi: 10.1371/journal.pntd.0006052. eCollection 2017 Dec. 10.1371/journal.pntd.0006052