Molecule Information

General Information of the Molecule (ID: Mol02042)

• Name: Cholinergic receptor muscarinic 1 (CHRM1) ,Guinea-pig
• Synonyms: GPM1
• Molecule Type: Protein
• Gene Name: CHRM1
• Sequence:
  MNTSAPPAVSPNITILAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
  NYFLLSLACADLIIGTSSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
  FDRYFSVTRPLSYRTKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGEQTVLAGQCYI
  QFLSQPIITFGTAMAAFYLPVTVMCALYWRIYRETENRARELAALQGSETPGKGGGSSSS
  SERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
  VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
  KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
  CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGCLHRTPSR
• Function: The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
• Uniprot ID: Q8VH28_CAVPO
• HGNC ID: HGNC:1950

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Rodentia
Family: Caviidae
Genus: Cavia
Species: .

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Dicyclomine

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Asthma [1]

• Sensitive Disease: Asthma [ICD-11: CA23.0]
• Sensitive Drug: Dicyclomine
• Molecule Alteration: Function; Inhibition
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vivo Model: Guinea-pig model; Cavia cutleri
• Experiment for Molecule Alteration: cAMP estimation analysis
• Mechanism Description: Dicyclomine, an antagonist of muscarinic receptors as well as an inhibitor of Ca++ ion influx, exhibited a similar pattern of inhibition with lower EC50 values against CCh when compared with high K+. In isolated guinea pig trachea, TS Oil inhibited carbachol (CCh, 1 M) and K+ (80 mM)-induced contractions in a pattern similar to that of dicyclomine. Methicillin-resistant S. aureus (MRSA) showed a small zone of inhibition as compared to standard strains (22 mm).

References

• Ref 1: Possible Tracheal Relaxant and Antimicrobial Effects of the Essential Oil of Ethiopian Thyme Species (Thymus serrulatus Hochst. ex Benth.): A Multiple Mechanistic Approach .Front Pharmacol. 2021 Apr 5;12:615228. doi: 10.3389/fphar.2021.615228. eCollection 2021. 10.3389/fphar.2021.615228