Molecule Information

General Information of the Molecule (ID: Mol02022)

• Name: Beta-lactamase (Q9X4S7) ,Prevotella intermedia
• Synonyms: cfxA2; CLI70_02470; CTI18_10205; CTM44_04660; CTM46_08920; CTM50_00090; CTM53_10840; CTM59_09130; CTM62_10610; CUB95_12895; CUB97_12180
• Molecule Type: Protein
• Gene Name: Q9X4S7
• Gene ID: 57246820
• Sequence:
  MEKNRKKQIVVLSIALVCIFILVFSLFHKSATKDSANPPLTNVLTDSISQIVSACPGEIG
  VAVIVNNRDTVKVNNKSVYPMMSVFKVHQALALCNDFDNKGISLDTLVNINRDKLDPKTW
  SPMLKDYSGPVISLTVRDLLRYTLTQSDNNASNLMFKDMVNVAQTDSFIATLIPRSSFQI
  AYTEEEMSADHNKAYSNYTSPLGAAMLMNRLFTEGLIDDEKQSFIKNTLKECKTGVDRIA
  APLLDKEGVVIAHKTGSGYVNENGVLAAHNDVAYICLPNNISYTLAVFVKDFKGNESQAS
  QYVAHISAVVYSLLMQTSVKS
• Uniprot ID: Q9X4S7_PREIN

Kingdom: N.A.
Phylum: Bacteroidetes
Class: Bacteroidia
Order: Bacteroidales
Family: Prevotellaceae
Genus: Prevotella
Species: Prevotella intermedia

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 3 drug(s) in total

Amoxicillin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Chronic periodontitis [1]

• Resistant Disease: Chronic periodontitis [ICD-11: DA0C.Y]
• Resistant Drug: Amoxicillin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Prevotella nigrescens strain; 28133
• Experiment for Molecule Alteration: PCR
• Experiment for Drug Resistance: Disc diffusion test
• Mechanism Description: Seventy five percent of patients carried two species of beta-lactamase-producing anaerobic bacteria that comprised 9.4% of the total number of cultivable bacteria. Fifty one percent of beta-lactamase-producing strains mainly Prevotella, Porphyromonas, and Bacteroides carried the cfxA gene, whereas none of them carried blaTEM. Further characterization of the cfxA gene showed that 76.7% of these strains carried the cfxA2 gene, 14% carried cfxA3, and 9.3% carried cfxA6. The cfxA6 gene was present in three Prevotella spp. and in one Porphyromonas spp. Strains containing cfxA genes (56%) were resistant to the beta-lactam antibiotics.

Disease Class: Chronic periodontitis [1]

• Resistant Disease: Chronic periodontitis [ICD-11: DA0C.Y]
• Resistant Drug: Amoxicillin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Porphyromonas gingivalis strain; 837
• Experiment for Molecule Alteration: PCR
• Experiment for Drug Resistance: Disc diffusion test
• Mechanism Description: Seventy five percent of patients carried two species of beta-lactamase-producing anaerobic bacteria that comprised 9.4% of the total number of cultivable bacteria. Fifty one percent of beta-lactamase-producing strains mainly Prevotella, Porphyromonas, and Bacteroides carried the cfxA gene, whereas none of them carried blaTEM. Further characterization of the cfxA gene showed that 76.7% of these strains carried the cfxA2 gene, 14% carried cfxA3, and 9.3% carried cfxA6. The cfxA6 gene was present in three Prevotella spp. and in one Porphyromonas spp. Strains containing cfxA genes (56%) were resistant to the beta-lactam antibiotics.

Ampicillin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Chronic periodontitis [1]

• Resistant Disease: Chronic periodontitis [ICD-11: DA0C.Y]
• Resistant Drug: Ampicillin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Prevotella nigrescens strain; 28133
• Experiment for Molecule Alteration: PCR
• Experiment for Drug Resistance: Disc diffusion test
• Mechanism Description: Seventy five percent of patients carried two species of beta-lactamase-producing anaerobic bacteria that comprised 9.4% of the total number of cultivable bacteria. Fifty one percent of beta-lactamase-producing strains mainly Prevotella, Porphyromonas, and Bacteroides carried the cfxA gene, whereas none of them carried blaTEM. Further characterization of the cfxA gene showed that 76.7% of these strains carried the cfxA2 gene, 14% carried cfxA3, and 9.3% carried cfxA6. The cfxA6 gene was present in three Prevotella spp. and in one Porphyromonas spp. Strains containing cfxA genes (56%) were resistant to the beta-lactam antibiotics.

Disease Class: Chronic periodontitis [1]

• Resistant Disease: Chronic periodontitis [ICD-11: DA0C.Y]
• Resistant Drug: Ampicillin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Porphyromonas gingivalis strain; 837
• Experiment for Molecule Alteration: PCR
• Experiment for Drug Resistance: Disc diffusion test
• Mechanism Description: Seventy five percent of patients carried two species of beta-lactamase-producing anaerobic bacteria that comprised 9.4% of the total number of cultivable bacteria. Fifty one percent of beta-lactamase-producing strains mainly Prevotella, Porphyromonas, and Bacteroides carried the cfxA gene, whereas none of them carried blaTEM. Further characterization of the cfxA gene showed that 76.7% of these strains carried the cfxA2 gene, 14% carried cfxA3, and 9.3% carried cfxA6. The cfxA6 gene was present in three Prevotella spp. and in one Porphyromonas spp. Strains containing cfxA genes (56%) were resistant to the beta-lactam antibiotics.

Penicillin V

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Chronic periodontitis [1]

• Resistant Disease: Chronic periodontitis [ICD-11: DA0C.Y]
• Resistant Drug: Penicillin V
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Prevotella nigrescens strain; 28133
• Experiment for Molecule Alteration: PCR
• Experiment for Drug Resistance: Disc diffusion test
• Mechanism Description: Seventy five percent of patients carried two species of beta-lactamase-producing anaerobic bacteria that comprised 9.4% of the total number of cultivable bacteria. Fifty one percent of beta-lactamase-producing strains mainly Prevotella, Porphyromonas, and Bacteroides carried the cfxA gene, whereas none of them carried blaTEM. Further characterization of the cfxA gene showed that 76.7% of these strains carried the cfxA2 gene, 14% carried cfxA3, and 9.3% carried cfxA6. The cfxA6 gene was present in three Prevotella spp. and in one Porphyromonas spp. Strains containing cfxA genes (56%) were resistant to the beta-lactam antibiotics.

Disease Class: Chronic periodontitis [1]

• Resistant Disease: Chronic periodontitis [ICD-11: DA0C.Y]
• Resistant Drug: Penicillin V
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Porphyromonas gingivalis strain; 837
• Experiment for Molecule Alteration: PCR
• Experiment for Drug Resistance: Disc diffusion test
• Mechanism Description: Seventy five percent of patients carried two species of beta-lactamase-producing anaerobic bacteria that comprised 9.4% of the total number of cultivable bacteria. Fifty one percent of beta-lactamase-producing strains mainly Prevotella, Porphyromonas, and Bacteroides carried the cfxA gene, whereas none of them carried blaTEM. Further characterization of the cfxA gene showed that 76.7% of these strains carried the cfxA2 gene, 14% carried cfxA3, and 9.3% carried cfxA6. The cfxA6 gene was present in three Prevotella spp. and in one Porphyromonas spp. Strains containing cfxA genes (56%) were resistant to the beta-lactam antibiotics.

References

• Ref 1: Detection of cfxA2, cfxA3, and cfxA6 genes in beta-lactamase producing oral anaerobes .J Appl Oral Sci. 2016 Apr;24(2):142-7. doi: 10.1590/1678-775720150469. 10.1590/1678-775720150469