Molecule Information

General Information of the Molecule (ID: Mol02021)

• Name: Short-chain diamines transporter (PACE) ,Acinetobacter baumannii
• Synonyms: aceI; A1S_2063
• Molecule Type: Protein
• Gene Name: PACE
• Gene ID: 56377069
• Sequence:
  MLISKRRLIHAISYEGILLVIIAIALSFIFNMPMEVTGTLGVFMAVVSVFWNMIFNHYFE
  KVEHKYNWERTIPVRILHAIGFEGGLLIATVPMIAYMMQMTVIDAFILDIGLTLCILVYT
  FIFQWCYDHIEDKFFPNAKAASLH
• Function: Mediates the efflux of short-chain diamines when energized by an electrochemical gradient. Recognizes specifically the short-chain diamines cadaverine and putrescine as substrates, and promotes the active transport of these substrates in exchange for a cation. Protons are probably the primary source of energy for transport, however it was not possible to conclude with complete certainty that protons, rather than alternative cations such as Na(+) ions, are exchanged for substrates by AceI. In addition, is involved in resistance to the synthetic biocide chlorhexidine, a widely used antiseptic and disinfectant in both hospital and community settings. Interacts directly with chlorhexidine and mediates its efflux via an energy-dependent mechanism.
• Uniprot ID: PACE_ACIBT

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: 2887326
Family: Moraxellaceae
Genus: Acinetobacter
Species: Acinetobacter baumannii

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Proflavine

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Klebsiella pneumoniae infection [1]

• Resistant Disease: Klebsiella pneumoniae infection [ICD-11: CA40.1]
• Resistant Drug: Proflavine
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Burkholderia cenocepacia HI2424; 95486
• In Vitro Model: Klebsiella pneumoniae 342; 573
• In Vitro Model: Pseudomonas syringae pv. Tomato strain DC3000; 323
• In Vitro Model: Vibrio parahaemolyticus strain; 670
• Experiment for Molecule Alteration: Western blotting analysis
• Experiment for Drug Resistance: Broth dilution assay
• Mechanism Description: The novel AceI (Acinetobacter chlorhexidine efflux) protein from Acinetobacter baumannii that conferred resistance to the biocide chlorhexidine, via an active efflux mechanism. MIC analyses demonstrated that, like AceI, many of the homologs conferred resistance to chlorhexidine. Many of the AceI homologs conferred resistance to additional biocides, including benzalkonium, dequalinium, proflavine, and acriflavine.

References

• Ref 1: Homologs of the Acinetobacter baumannii AceI transporter represent a new family of bacterial multidrug efflux systems .mBio. 2015 Feb 10;6(1):e01982-14. doi: 10.1128/mBio.01982-14. 10.1128/mBio.01982-14