Molecule Information

General Information of the Molecule (ID: Mol01992)

• Name: Transcription factor PDR1 (PDR1) ,Saccharomyces cerevisiae
• Synonyms: PDR1; AMY1; ANT1; BOR2; CYH3; NRA2; SMR2; TIL1; TPE1; TPE3; YGL013C
• Molecule Type: Protein
• Gene Name: PDR1
• Gene ID: 852871
• Sequence:
  MRGLTPKNGVHIETGPDTESSADSSNFSTGFSGKIRKPRSKVSKACDNCRKRKIKCNGKF
  PCASCEIYSCECTFSTRQGGARIKNLHKTSLEGTTVQVKEETDSSSTSFSNPQRCTDGPC
  AVEQPTKFFENFKLGGRSSGDNSGSDGKNDDDVNRNGFYEDDSESQATLTSLQTTLKNLK
  EMAHLGTHVTSAIESIELQISDLLKRWEPKVRTKELATTKFYPNKSIETQLMKNKYCDVV
  HLTRYAAWSNNKKDQDTSSQPLIDEIFGLYSPFQFLSLQGIGKCFQNYRSKSKCEIFPRT
  AKETIYIMLRFFDVCFHHINQGCVSIANPLENYLQKMNLLPSTPSSISSAGSPNTAHTKS
  HVALVINHLPQPFVRNITGISNSELLSEMNNDISMFGILLKMLDMHKNSYQNFLMEITSN
  PSVAKNTQSIDVLQEFIHYCQAGEALIALCYSYYNSTLYNYVDFTCDITHLEQLLYFLDL
  LFWLSEIYGFEKVLNVAVHFVSRVGLSRWEFYVGLDENFAERRRNLWWKAFYFEKTLASK
  LGYPSNIDDSKINCLLPKNFRDVGFLDNRDFIENVHLVRRSEAFDNMCISDLKYYGELAV
  LQIVSHFSSSVLFNEKFTSIRNTSKPSVVREKLLFEVLEIFNETEMKYDAIKEQTGKLFD
  IAFSKDSTELKVSREDKIMASKFVLFYEHHFCRMVNESDNIVARLCVHRRPSILIENLKI
  YLHKIYKSWTDMNKILLDFDNDYSVYRSFAHYSISCIILVSQAFSVAEFIKVNDVVNMIR
  VFKRFLDIKIFSENETNEHVFNSQSFKDYTRAFSFLTIVTRIMLLAYGESSSTNLDVISK
  YIDENAPDLKGIIELVLDTNSCAYRFLLEPVQKSGFHLTVSQMLKNRKFQEPLMSNEDNK
  QMKHNSGKNLNPDLPSLKTGTSCLLNGIESPQLPFNGRSAPSPVRNNSLPEFAQLPSFRS
  LSVSDMINPDYAQPTNGQNNTQVQSNKPINAQQQIPTSVQVPFMNTNEINNNNNNNNNNK
  NNINNINNNNSNNFSATSFNLGTLDEFVNNGDLEDLYSILWSDVYPDS
• Function: Positive regulator of proteins involved in permeability. PDR1 and PDR3 jointly control the transcription level of both SNQ2 and PDR5.
• Uniprot ID: PDR1_YEAST

Kingdom: Fungi
Phylum: Ascomycota
Class: Saccharomycetes
Order: 4892
Family: Saccharomycetaceae
Genus: Saccharomyces
Species: Saccharomyces cerevisiae

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Cantharidin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Sacharomyces cerevisiae infection [1]

• Resistant Disease: Sacharomyces cerevisiae infection [ICD-11: 1F29-1F2F]
• Resistant Drug: Cantharidin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: TRAMP-C2 cells; Prostate; Homo sapiens (Human); CVCL_3615
• Experiment for Molecule Alteration: Western blot analysis; Fluorescence microscopy assay
• Experiment for Drug Resistance: Spot dilution assay; Liquid media growth curve analysis; Colony forming unit (CFU) assay
• Mechanism Description: ABC transporter Pdr5 is required for cantharidin resistance in Saccharomyces cerevisiae. Cantharidin mediated upregulation of Pdr5 is majorly regulated by Pdr1, cantharidin induced the upregulation of both PDR1 and PDR5 genes., PDR5 is the main cantharidin resistance gene.

Lovastatin

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Fungal infection [2]

• Sensitive Disease: Fungal infection [ICD-11: 1F29-1F2F]
• Sensitive Drug: Lovastatin
• Molecule Alteration: Deletion mutation; Deleteion
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Saccharomyces cerevisiae strain Y12409; 4932
• In Vitro Model: Saccharomyces cerevisiae strain Y13029; 4932
• In Vitro Model: Saccharomyces cerevisiae strain Y13951; 4932
• In Vitro Model: Saccharomyces cerevisiae strain Y14381; 4932
• In Vitro Model: Sarcoma tissue; .
• Experiment for Molecule Alteration: PCR
• Experiment for Drug Resistance: Spot Test
• Mechanism Description: We investigated the susceptibility to lovastatin of S. cerevisiae strains deleted for PDR genes, responsible for exporting hydrophobic and amphiphilic drugs, such as lovastatin. Strains deleted for the genes tested, PDR1, PDR3, PDR5 and SNQ2, exhibited remarkably different phenotypes, with deletion of PDR5 causing the highest sensitivity to lovastatin. The study helped clarifying which pdr mutants to use in studies of physiological actions of statins in yeast.

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Fungal infection [2]

• Sensitive Disease: Fungal infection [ICD-11: 1F29-1F2F]
• Sensitive Drug: Lovastatin
• Molecule Alteration: Deletion mutation; Deleteion
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Saccharomyces cerevisiae strain Y12409; 4932
• In Vitro Model: Saccharomyces cerevisiae strain Y13029; 4932
• In Vitro Model: Saccharomyces cerevisiae strain Y13951; 4932
• In Vitro Model: Saccharomyces cerevisiae strain Y14381; 4932
• In Vitro Model: Sarcoma tissue; .
• Experiment for Molecule Alteration: PCR
• Experiment for Drug Resistance: Spot Test
• Mechanism Description: We investigated the susceptibility to lovastatin of S. cerevisiae strains deleted for PDR genes, responsible for exporting hydrophobic and amphiphilic drugs, such as lovastatin. Strains deleted for the genes tested, PDR1, PDR3, PDR5 and SNQ2, exhibited remarkably different phenotypes, with deletion of PDR5 causing the highest sensitivity to lovastatin. The study helped clarifying which pdr mutants to use in studies of physiological actions of statins in yeast.

References

• Ref 1: ABC transporter Pdr5 is required for cantharidin resistance in Saccharomyces cerevisiae .Biochem Biophys Res Commun. 2021 May 14;553:141-147. doi: 10.1016/j.bbrc.2021.03.074. Epub 2021 Mar 24. 10.1016/j.bbrc.2021.03.074
• Ref 2: Sensitivity to lovastatin of Saccharomyces cerevisiae strains deleted for pleiotropic drug resistance (PDR) genes .J Mol Microbiol Biotechnol. 2011;20(4):191-5. doi: 10.1159/000329068. Epub 2011 Jul 12. 10.1159/000329068