Molecule Information

General Information of the Molecule (ID: Mol01984)

• Name: Interleukin 23 receptor (IL23R) ,Homo sapiens
• Synonyms: IL23R
• Molecule Type: Protein
• Gene Name: IL23R
• Gene ID: 149233
• Location: chr1:67,138,907-67,259,979[+]
• Sequence:
  MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQ
  PRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDIS
  SGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYIN
  ISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETINATVPKTII
  YWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETG
  KRYWQPWSSLFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGLLLGM
  IVFAVMLSILSLIGIFNRSFRTGIKRRILLLIPKWLYEDIPNMKNSNVVKMLQENSELMN
  NNSSEQVLYVDPMITEIKEIFIPEHKPTDYKKENTGPLETRDYPQNSLFDNTTVVYIPDL
  NTGYKPQISNFLPEGSHLSNNNEITSLTLKPPVDSLDSGNNPRLQKHPNFAFSVSSVNSL
  SNTIFLGELSLILNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGI
  VNEELPSINTYFPQNILESHFNRISLLEK
• Function: Associates with IL12RB1 to form the interleukin-23 receptor. Binds IL23 and mediates T-cells, NK cells and possibly certain macrophage/myeloid cells stimulation probably through activation of the Jak-Stat signaling cascade. IL23 functions in innate and adaptive immunity and may participate in acute response to infection in peripheral tissues. IL23 may be responsible for autoimmune inflammatory diseases and be important for tumorigenesis.
• Uniprot ID: IL23R_HUMAN
• Ensembl ID: ENSG00000162594
• HGNC ID: HGNC:19100

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Tildrakizumab

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Nail psoriasis [1]

• Sensitive Disease: Nail psoriasis [ICD-11: EA90.50]
• Sensitive Drug: Tildrakizumab
• Molecule Alteration: Function; Inhibition
• Experimental Note: Discovered Using In-vivo Testing Model
• Mechanism Description: Tildrakizumab, an IL-23 inhibitor, has shown significant clinical improvement in the treatment of moderate-to-severe chronic plaque psoriasis. We report 2 cases of treatment resistant nail psoriasis which showed marked improvement with the use of off-label tildrakizumab.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 14

Psoriasis [ICD-11: EA90]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Skin
• The Specified Disease: Psoriasis
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 2.15E-01; Fold-change: -4.64E-02; Z-score: -2.52E-01
• The Expression Level of Disease Section Compare with the Adjacent Tissue: p-value: 1.74E-21; Fold-change: 2.22E-01; Z-score: 1.47E+00

References

• Ref 1: Successful management of treatment resistant nail psoriasis with tildrakizumab .Australas J Dermatol. 2021 Aug;62(3):390-393. doi: 10.1111/ajd.13642. Epub 2021 Jun 11. 10.1111/ajd.13642