Molecule Information

General Information of the Molecule (ID: Mol01196)

Name	Aminoglycoside 3'-phosphotransferase (A3AP) ,Escherichia coli
Molecule Type	Protein
Gene Name	APH(4)-Ia
Sequence	MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKD RYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEAMD AIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDE LMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMFGDSQYEVANIFFWRPWLA CMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSG AGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAKE Click to Show/Hide
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Escherichia Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Hygromycin B

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Escherichia coli infection			[1]
Resistant Disease	Escherichia coli infection [ICD-11: 1A03.0]		Disease Info
Resistant Drug	Hygromycin B		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli strain BE904		562
	Escherichia coli strain CSR603		562
	Escherichia coli strain DH1		536056
	Escherichia coli strain JA221		562
	Escherichia coli strain k12		83333
	Escherichia coli strain RR1		562
Experiment for Molecule Alteration	DNA sequencing assay
Experiment for Drug Resistance	O-galactosidase assay
Mechanism Description	Hygromycin B resistance is mediated by an aminocyc1ito1 phosphotransferase that inactivates by covalent addition of a phosphate to the 4-position of hygromycin B. The gene is abbreviated as aph(4).

References

Ref 1	Analysis of a bacterial hygromycin B resistance gene by transcriptional and translational fusions and by DNA sequencing. Nucleic Acids Res. 1983 Oct 11;11(19):6895-911. doi: 10.1093/nar/11.19.6895.