Molecule Information

General Information of the Molecule (ID: Mol01177)

• Name: Colistin resistance PEtN transferase (ICRMc ) ,Moraxella catarrhalis
• Molecule Type: Protein
• Gene Name: ICR-Mc
• Sequence:
  MSLKHNQTHNTTFTKFLKSNSFWSKGFWSNRHHRTKDLKGLDAYLFMAIVAIFLTTTANV
  TFFQQVMSVYPLANYAPFIASLAVVLTGVLLLLLVLLGYRHTLKTVAICFILIAAFAGHF
  TDTYGTVYDTTMLQNALQTDTAETKDLLSMKLLIRVVLLAGLPICWIIGQPLSFGTLKAS
  LMKRLVTYLVALALVGLPILAFSSQYASFFREHKPLRFFTNPVTVMYSAGKLANMSYKNA
  TKPTETIMHANDAIQKTTASTRKPRLVVMVVGETARADHASFNGYQRATFPHMDKLIGLG
  QVHNFGNVTSCGTSTAYSVPCMFSYLGAEKYDVDTADYHENVIDTLDRLGVAILWRDNNS
  DSKGVMNRLPAKQYQDYKNSPLQGGNNTICHTNPYDECRDVGMLVDLDDHVKAHANQDIL
  IVLHQMGNHGPAYYKRYDDEFAQFLPVCTSSELAECERQTVINAYDNALLATDDFLKQTI
  DWLAAQTHADTAMLYLSDHGESLGEKGVYLHGMPKAFAPKEQLSIPALLWLGADTPFAVA
  NSPTAGFSHDAITPTLLNLFDVSTQATADKTAFVNPLD

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Moraxellales
Family: Moraxellaceae
Genus: Moraxella
Species: Moraxella catarrhalis

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Colistin A

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Colistin A
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli BW25113; 679895
• Mechanism Description: Diverse covalent modifications of LPS, which include among others the addition of phosphoethanolamine (PEtN) groups are thought to alter the physical properties of the outer membrane, resulting in polymyxin resistance. The increased clinical and agricultural use of colistin has been linked to the mobilization and transfer of colistin resistance elements to human pathogenic bacteria.53 resistance elements to human pathogenic bacteria.

Colistin B

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Colistin B
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli BW25113; 679895
• Mechanism Description: Diverse covalent modifications of LPS, which include among others the addition of phosphoethanolamine (PEtN) groups are thought to alter the physical properties of the outer membrane, resulting in polymyxin resistance. The increased clinical and agricultural use of colistin has been linked to the mobilization and transfer of colistin resistance elements to human pathogenic bacteria.53 resistance elements to human pathogenic bacteria.

References

• Ref 1: Substrate Recognition by a Colistin Resistance Enzyme from Moraxella catarrhalis. ACS Chem Biol. 2018 May 18;13(5):1322-1332. doi: 10.1021/acschembio.8b00116. Epub 2018 Apr 19.