Molecule Information

General Information of the Molecule (ID: Mol01174)

• Name: Transcriptional regulatory protein LiaR (LIAR) ,Enterococcus faecalis
• Molecule Type: Protein
• Gene Name: liaR
• Sequence:
  MIKVLLVDDHEMVRLGVSSYLSIQEDIEVIGEAENGRQGYEKAMTLRPDVILMDLVMEEM
  DGIESTKAILKDWPEAKIIIVTSFIDDEKVYPAIEAGAAGYLLKTSTAHEIADAIRATQR
  GERVLEPEVTTKMMEKMSRRNEPVLHEELTNRENEILMLISEGKSNQEIADELFITLKTV
  KTHVSNILAKLEVEDRTQAAIYAFKHGLVK
• Function: liaR is a response regulator found in the liaFSR signal transduction pathway. Mutations confer daptomycin resistance.

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Enterococcaceae
Genus: Enterococcus
Species: Enterococcus faecalis

Type(s) of Resistant Mechanism of This Molecule

  EADR: Epigenetic Alteration of DNA, RNA or Protein

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Daptomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Epigenetic Alteration of DNA, RNA or Protein (EADR)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Daptomycin
• Molecule Alteration: Missense mutation; p.D191N
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Enterococcus faecalis S613; 699185
• Experiment for Molecule Alteration: Whole genome sequence assay; Allelic frequency measurement assay
• Experiment for Drug Resistance: Agar dilution method assay
• Mechanism Description: LiaFSR is a component of the CESR regulon and responds to changes in cell envelope integrity by regulating downstream genes to counteract damage.LiaFSR mutations occurred in liaF (78%), with changes in yvlB (12%) and liaR (4%) comprising the remainder.

References

• Ref 1: Adaptation of Enterococcus faecalis to daptomycin reveals an ordered progression to resistance. Antimicrob Agents Chemother. 2013 Nov;57(11):5373-83. doi: 10.1128/AAC.01473-13. Epub 2013 Aug 19.