Molecule Information

General Information of the Molecule (ID: Mol01172)

Name	Colistin resistance protein (MCR-3.3-Unclear) ,Aeromonas veronii
Molecule Type	Protein
Gene Name	MCR-3.3
Sequence	MPSLIKIKIVPLMFFLALYFAFMLNWRGVLHFYEILYKLEDFKFGFAISLPILLVAALNF VFVPFSIRYLIKPFFALLIALSAIVSYTMMKYRVLFDQNMIQNIFETNQNEALAYLSLPI IGWVTIAGFIPAILLFFVEIEYEEKWFKGILTRALSMFASLIVIAVIAALYYQDYVSVGR NNSNLQREIVPANFVNSTVKYVYNRYLAEPIPFTTLGDDAKRDTNQSKPTLMFLVVGETA RGKNFSMNGYEKDTNPFTSKSGGVISFNDVRSCGTATAVSVPCMFSNMGRKEFDDNLARN SEGLLDVLQKTGVSIFWKENDGGCKGVCDRVPNIEIKPKDYPKFCDKNTCYDEVVLQELD SEIAQMKGDKLVGFHLIGSHGPTYYKRYPDAHRQFTPDCPRSDIENCTDEELTNTYDNTI RYTDFVIAEMIAKLKTYEDKYNTALLYVSDHGESLGALGLYLHGTPYKFAPDDQTRVPMQ VWMSPGFIKEKGMNMECLQKNAAANRYSHDNIFSSVLGIWDVKTAIYEQELDIFKQCRNN Click to Show/Hide
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Aeromonadales Family: Aeromonadaceae Genus: Aeromonas Species: Aeromonas veronii

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s)

2 drug(s) in total

Click to Show/Hide the Full List of Drugs

Colistin A

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Gram-negative bacterial infection			[1]
Resistant Disease	Gram-negative bacterial infection [ICD-11: 1B74-1G40]		Disease Info
Resistant Drug	Colistin A		Drug Info
Molecule Alteration	Mutation	.
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli ATCC 25922		1322345
	Aeromonas veronii 172		654
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Agar dilution method assay
Mechanism Description	This strain showed resistance to both Beta-lactams and phenicols and had borderline susceptibility to colistin, which was mediated by mcr-3.3 alone.

Colistin B

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Gram-negative bacterial infection			[1]
Resistant Disease	Gram-negative bacterial infection [ICD-11: 1B74-1G40]		Disease Info
Resistant Drug	Colistin B		Drug Info
Molecule Alteration	Mutation	.
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli ATCC 25922		1322345
	Aeromonas veronii 172		654
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Agar dilution method assay
Mechanism Description	This strain showed resistance to both Beta-lactams and phenicols and had borderline susceptibility to colistin, which was mediated by mcr-3.3 alone.

References

Ref 1	Chromosome-Mediated mcr-3 Variants in Aeromonas veronii from Chicken Meat. Antimicrob Agents Chemother. 2017 Oct 24;61(11):e01272-17. doi: 10.1128/AAC.01272-17. Print 2017 Nov.