Molecule Information

General Information of the Molecule (ID: Mol01134)

• Name: Viomycin phosphotransferase (VPH) ,Streptomyces vinaceus
• Synonyms: Viomycin kinase
• Molecule Type: Protein
• Gene Name: vph
• Gene ID: 63984161
• Sequence:
  MRIIETHRDLLSRLLPGDTVGGLAVHEGQFHHVVIGSHRVVCFARTRAAADRLPGRADVL
  RALAGIDLGFRTPQPLSEGGAQGTDEPPYLVLSRIPGAPLEDDVLTSPEVAEAVARQYAT
  LLSGLAAAGDEEKVRAALPEAPANEWQEFATGVRTELFPLMSDGGRERAERELAALDALP
  HLTSAVVHGDLGGENVLWETVDGVPRMSGVVDWDEVGIGDPAEDLAAIGASYGEELLGRV
  LALGGWADNGTAERISAIRGTFALQQALYAQRDGDEEELADGLSGYR
• Function: The aminoglycoside phosphotransferases achieve inactivation of their antibiotic substrates by phosphorylation.
• Uniprot ID: VPH_STRVI

Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Streptomycetales
Family: Streptomycetaceae
Genus: Streptomyces
Species: Streptomyces vinaceus

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Viomycin sulfate

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Escherichia coli infection [1]

• Resistant Disease: Escherichia coli infection [ICD-11: 1A03.0]
• Resistant Drug: Viomycin sulfate
• Molecule Alteration: Expression; Acquired
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli JM109; 562
• In Vitro Model: Escherichia coli strain ED8767; 562
• In Vitro Model: Streptomyces lividans strain M252; 1916
• In Vitro Model: Streptomyces lividans strain 66; 1200984
• In Vitro Model: Escherichia coli strain W5445; 562
• In Vitro Model: Streptomyces lividans strain M264; 1916
• In Vitro Model: Streptomyces lividans strain M274; 1916
• Experiment for Molecule Alteration: DNA sequencing assay
• Mechanism Description: Insertion of the BamHI fragment containing this sequence (vph) into the unique BamHI site of pBR322, in one orientation, led to expression of viomycin resistance in Escherichia coli.

Disease Class: Streptomyces vinaceus infection [1]

• Resistant Disease: Streptomyces vinaceus infection [ICD-11: 1C43.11]
• Resistant Drug: Viomycin sulfate
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli JM109; 562
• In Vitro Model: Escherichia coli strain ED8767; 562
• In Vitro Model: Streptomyces lividans strain M252; 1916
• In Vitro Model: Streptomyces lividans strain 66; 1200984
• In Vitro Model: Escherichia coli strain W5445; 562
• In Vitro Model: Streptomyces lividans strain M264; 1916
• In Vitro Model: Streptomyces lividans strain M274; 1916
• Experiment for Molecule Alteration: DNA sequencing assay
• Mechanism Description: Promoter-probe plasmid vectors were used to isolate putative promoter-containing DNA fragments of three Streptomyces antibiotic resistance genes, the rRNA methylase (tsr) gene of S. azureus, the aminoglycoside phosphotransferase (aph) gene of S. fradiae, and the viomycin phosphotransferase (vph) gene of S. vinaceus.

References

• Ref 1: Nucleotide sequences encoding and promoting expression of three antibiotic resistance genes indigenous to Streptomyces. Mol Gen Genet. 1985;199(1):26-36. doi: 10.1007/BF00327505.