Molecule Information

General Information of the Molecule (ID: Mol01092)

• Name: Streptomycin 3''-kinase (APHE) ,Streptomyces griseus
• Synonyms: Streptomycin 3''-phosphotransferase; Streptomycin 6-kinase; Streptomycin 6-phosphotransferase
• Molecule Type: Protein
• Gene Name: aphE
• Sequence:
  MSDHPGPGAVTPELFGVGGDWLAVTAGESGASVFRAADATRYAKCVPAADAAGLEAERDR
  IAWLSGQGVPGPRVLDWYAGDAGACLVTRAVPGVPADRVGADDLRTAWGAVADAVRRLHE
  VPVASCPFRRGLDSVVDAARDVVARGAVHPEFLPVEQRLVPPAELLARLTGELARRRDQE
  AADTVVCHGDLCLPNIVLHPETLEVSGFIDLGRLGAADRHADLALLLANARETWVDEERA
  RFADAAFAERYGIAPDPERLRFYLHLDPLTWG
• Function: The aminoglycoside phosphotransferases achieve inactivation of their antibiotic substrates by phosphorylation.
• Uniprot ID: APHE_STRGR

Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Streptomycetales
Family: Streptomycetaceae
Genus: Streptomyces
Species: Streptomyces griseus

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Streptomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Streptomyces griseus infection [1]

• Resistant Disease: Streptomyces griseus infection [ICD-11: 1C43.7]
• Resistant Drug: Streptomycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Streptomyces griseus strain ATCC 12475; 1911
• Mechanism Description: The aminoglycoside phosphotransferases are prokaryotic antibiotic resistance proteins that achieve inactivation of their antibiotic substrates by phosphorylation. To assist in our structure/function investigations of this group of kinases a gene encoding a streptomycin phosphotransferase (aphE) was cloned from the chromosomal DNA of the streptomycin producing Streptomyces griseus ATCC 12475 by the polymerase chain reaction (PCR).

References

• Ref 1: PCR cloning of a streptomycin phosphotransferase (aphE) gene from Streptomyces griseus ATCC 12475. Nucleic Acids Res. 1990 Aug 11;18(15):4615. doi: 10.1093/nar/18.15.4615.