Molecule Information

General Information of the Molecule (ID: Mol01091)

Name	Streptomycin 3''-adenylyltransferase (AADA27) ,Acinetobacter lwoffii
Synonyms	aadA27; Streptomycin 3''-adenylyltransferase Click to Show/Hide
Molecule Type	Protein
Gene Name	aadA27
Sequence	MSETLQLEQLTESLQQLLGESLFAIYLYGSAVDGGLGPESDLDVLVVVNQALTLHQRQQL AETLLKISYPIGAAQRALEVTIVLKEQILSGSYPLSYELQFGEWLREELNQGALLRAHTD PDLSILLKKAQMHHRSLLGPSLTQWSTAIPEQHLWQAMADTYPSIVAHWDEDADERNQIL ALCRIYFSLITNEIVPKDQAAHWVIAQLPSLHQPILQRMIQEYKGEIRKQNWQQQHQALG PVVDFLSSKIDEQFNKKSSLIK Click to Show/Hide
Uniprot ID	A0A1C7ZQH8_ACILW
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Moraxellales Family: Moraxellaceae Genus: Acinetobacter Species: Acinetobacter lwoffii

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

2 drug(s) in total

Click to Show/Hide the Full List of Drugs

Spectinomycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Spectinomycin		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Acinetobacter lwoffii VS15		28090
	Escherichia coli JM109		562
	Pseudomonas sp. Tik3		761262
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Agar dilution method assay
Mechanism Description	The genes aadA or ant(3")-1 encode streptomycin 3"-adenylyltransferase that mediates combined resistance to streptomycin and spectinomycin through an adenylation modification. aadA27 is a functionally active gene conferring high level of resistance to streptomycin and spectinomycin in the native A. lwoffii strain as well as in Escherichia coli.

Streptomycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Streptomycin		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Acinetobacter lwoffii VS15		28090
	Escherichia coli JM109		562
	Pseudomonas sp. Tik3		761262
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Agar dilution method assay
Mechanism Description	The genes aadA or ant(3")-1 encode streptomycin 3"-adenylyltransferase that mediates combined resistance to streptomycin and spectinomycin through an adenylation modification. aadA27 is a functionally active gene conferring high level of resistance to streptomycin and spectinomycin in the native A. lwoffii strain as well as in Escherichia coli.

References

Ref 1	The ancient small mobilizable plasmid pALWED1.8 harboring a new variant of the non-cassette streptomycin/spectinomycin resistance gene aadA27. Plasmid. 2016 Mar-May;84-85:36-43. doi: 10.1016/j.plasmid.2016.02.005. Epub 2016 Feb 16.