Molecule Information

General Information of the Molecule (ID: Mol01085)

Name	Spectinomycin 9-adenylyltransferase (ANT) ,Staphylococcus aureus
Synonyms	AAD(9); spc Click to Show/Hide
Molecule Type	Protein
Gene Name	ant
Gene ID	42043718
Sequence	MSNLINGKIPNQAIQTLKIVKDLFGSSIVGVYLFGSAVNGGLRINSDVDVLVVVNHSLPQ LTRKKLTERLMTISGKIGNTDSVRPLEVTVINRSEVVPWQYPPKREFIYGEWLRGEFENG QIQEPSYDPDLAIVLAQARKNSISLFGPDSSSILVSVPLTDIRRAIKDSLPELIEGIKGD ERNVILTLARMWQTVTTGEITSKDVAAEWAIPLLPKEHVTLLDIARKGYRGECDDKWEGL YSKVKALVKYMKNSIETSLN Click to Show/Hide
Function	Mediates bacterial resistance to the antibiotic spectinomycin but not streptomycin. Click to Show/Hide
Uniprot ID	S9AD_STAAU
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Firmicutes Class: Bacilli Order: Bacillales Family: Staphylococcaceae Genus: Staphylococcus Species: Staphylococcus aureus

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Spectinomycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2], [3]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Spectinomycin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Staphylococcus aureus BD404		1280
	Staphylococcus aureus RN4470		1280
	Staphylococcus aureus RN4491		1280
	Staphylococcus aureus RN4565		1280
	Staphylococcus aureus RN4652		1280
	Staphylococcus aureus RN4689		1280
	Staphylococcus aureus RN4934		1280
Experiment for Molecule Alteration	Whole genome sequence assay
Mechanism Description	The spc determinant encodes a unique adenyltransferase, AAD(9), that modifies spectinomycin but not streptomycin.

References

Ref 1	Identification of the novel spectinomycin resistance gene spw in methicillin-resistant and methicillin-susceptible Staphylococcus aureus of human and animal origin. J Antimicrob Chemother. 2013 Jul;68(7):1679-80. doi: 10.1093/jac/dkt081. Epub 2013 Mar 19.
Ref 2	Nucleotide sequence of a spectinomycin adenyltransferase AAD(9) determinant from Staphylococcus aureus and its relationship to AAD(3") (9). Mol Gen Genet. 1985;200(1):33-9. doi: 10.1007/BF00383309.
Ref 3	Transposon Tn554: complete nucleotide sequence and isolation of transposition-defective and antibiotic-sensitive mutants. EMBO J. 1985 Dec 1;4(12):3357-65.