Molecule Information

General Information of the Molecule (ID: Mol01079)

Name	rRNA methyltransferase PikR2 (PIKR2) ,Streptomyces venezuelae
Synonyms	pikR2; rRNA methyltransferase PikR2 Click to Show/Hide
Molecule Type	Protein
Gene Name	pikR2
Sequence	MAFSPQGGRHELGQNFLVDRSVIDEIDGLVARTKGPILEIGPGDGALTLPLSRHGRPITA VELDGRRAQRLGARTPGHVTVVHHDFLQYPLPRNPHVVVGNVPFHLTTAIMRRLLDAQHW HTAVLLVQWEVARRRAGVGGSTLLTAGWAPWYEFDLHSRVPARAFRPMPGVDGGVLAIRR RSAPLVGQVKTYQDFVRQVFTGKGNGLKEILRRTGRISQRDLATWLRRNEISPHALPKDL KPGQWASLWELTGGTADGSFDGTAGGGAAGSHGAARVGAGHPGGRVSASRRGVPQARRGR GHAVRSSTGTEPRWGRGRAESA Click to Show/Hide
Uniprot ID	Q9ZGI7_STRVZ
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Actinobacteria Class: Actinomycetia Order: Streptomycetales Family: Streptomycetaceae Genus: Streptomyces Species: Streptomyces venezuelae

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Kanamycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Kanamycin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli		668369
	Escherichia coli BL21(DE3)		469008
	Escherichia coli BL21(DE3)pLysS		866768
	Escherichia coli S17-1		1227813
	Streptomyces antibioticus ATCC 11891		1890
	Streptomyces venezuelae ATCC 15439		54571
Experiment for Molecule Alteration	Whole genome sequence assay
Mechanism Description	Modification of 23S rRNA, which is the target site for methymycin and its derivatives, by PikR1 and PikR2 is a primary self-resistance mechanism.

Clinical Trial Drug(s)

2 drug(s) in total

Click to Show/Hide the Full List of Drugs

Thiostrepton

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Thiostrepton		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli		668369
	Escherichia coli BL21(DE3)		469008
	Escherichia coli BL21(DE3)pLysS		866768
	Escherichia coli S17-1		1227813
	Streptomyces antibioticus ATCC 11891		1890
	Streptomyces venezuelae ATCC 15439		54571
Experiment for Molecule Alteration	Whole genome sequence assay
Mechanism Description	Modification of 23S rRNA, which is the target site for methymycin and its derivatives, by PikR1 and PikR2 is a primary self-resistance mechanism.

Apramycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Apramycin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli		668369
	Escherichia coli BL21(DE3)		469008
	Escherichia coli BL21(DE3)pLysS		866768
	Escherichia coli S17-1		1227813
	Streptomyces antibioticus ATCC 11891		1890
	Streptomyces venezuelae ATCC 15439		54571
Experiment for Molecule Alteration	Whole genome sequence assay
Mechanism Description	Modification of 23S rRNA, which is the target site for methymycin and its derivatives, by PikR1 and PikR2 is a primary self-resistance mechanism.

References

Ref 1	Beta-glucosylation as a part of self-resistance mechanism in methymycin/pikromycin producing strain Streptomyces venezuelae. Biochemistry. 2003 Dec 23;42(50):14794-804. doi: 10.1021/bi035501m.
Ref 2	A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12111-6. doi: 10.1073/pnas.95.21.12111.