Molecule Information

General Information of the Molecule (ID: Mol01060)

• Name: Fur1 uracil phosphoribosyltransferase (FUR1) ,Candida albicans
• Synonyms: fur1; EC 2.4.2.9
• Molecule Type: Protein
• Gene Name: fur1
• Sequence:
  MSVAKAVSKNVILLPQTNQLIGLYSIIRDQRTKRGDFVFYSDRIIRLLVEEGLNQLPVEE
  AIIKCHGGYEYKGAKFLGKICGVSIVRAGESMEMGLRDCCRSVRIGKILIQRDEETALPK
  LFYEKLPEDISERYVFLLDPMLATGGSAMMAVEVLLARGVKMDRILFLNLLAAPEGIKAF
  QDKYPDVKIITGGIDEKLDENKYIVPGLGDFGDRYYCI
• Uniprot ID: G1UA34_CANAX

Kingdom: Fungi
Phylum: Ascomycota
Class: Saccharomycetes
Order: Saccharomycetales
Family: Debaryomycetaceae
Genus: Candida
Species: Candida albicans

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Flucytosine

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Candida albicans infection [1]

• Resistant Disease: Candida albicans infection [ICD-11: 1F23.Y]
• Resistant Drug: Flucytosine
• Molecule Alteration: Missense mutation; p.R101C
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Candida albicans strain; 5476
• Experiment for Molecule Alteration: DNA sequencing assay
• Experiment for Drug Resistance: Broth microdilution method assay
• Mechanism Description: The epidemiological results presented here suggest that the substitution of thymine for cytosine at nucleotide position 301, resulting in a change from arginine to cysteine at amino acid position 101, is likely to be the most important mechanism of 5FC resistance found in C. albicans populations.

References

• Ref 1: Clade-specific flucytosine resistance is due to a single nucleotide change in the FUR1 gene of Candida albicans. Antimicrob Agents Chemother. 2004 Jun;48(6):2223-7. doi: 10.1128/AAC.48.6.2223-2227.2004.