Molecule Information

General Information of the Molecule (ID: Mol01051)

Name	Porin D (OPRD) ,Pseudomonas aeruginosa
Synonyms	Imipenem/basic amino acid-specific outer membrane pore; Outer membrane protein D2; PA0958 Click to Show/Hide
Molecule Type	Protein
Gene Name	oprD
Gene ID	881970
Sequence	MKVMKWSAIALAVSAGSTQFAVADAFVSDQAEAKGFIEDSSLDLLLRNYYFNRDGKSGSG DRVDWTQGFLTTYESGFTQGTVGFGVDAFGYLGLKLDGTSDKTGTGNLPVMNDGKPRDDY SRAGGAVKVRISKTMLKWGEMQPTAPVFAAGGSRLFPQTATGFQLQSSEFEGLDLEAGHF TEGKEPTTVKSRGELYATYAGETAKSADFIGGRYAITDNLSASLYGAELEDIYRQYYLNS NYTIPLASDQSLGFDFNIYRTNDEGKAKAGDISNTTWSLAAAYTLDAHTFTLAYQKVHGD QPFDYIGFGRNGSGAGGDSIFLANSVQYSDFNGPGEKSWQARYDLNLASYGVPGLTFMVR YINGKDIDGTKMSDNNVGYKNYGYGEDGKHHETNLEAKYVVQSGPAKDLSFRIRQAWHRA NADQGEGDQNEFRLIVDYPLSIL Click to Show/Hide
Function	Porin with a specificity for basic amino acids. Also possesses serine protease activity. Click to Show/Hide
Uniprot ID	PORD_PSEAE
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Pseudomonadales Family: Pseudomonadaceae Genus: Pseudomonas Species: Pseudomonas aeruginosa

Type(s) of Resistant Mechanism of This Molecule

IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Imipenem

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2], [3]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Imipenem		Drug Info
Molecule Alteration	Missense mutation	c.752insAGTC
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Pseudomonas aeruginosa isolates		287
	Pseudomonas aeruginosa PAO1		208964
Experiment for Molecule Alteration	Whole genome sequence assay
Mechanism Description	P. aeruginosa OprD is a 443-amino-acid protein that facilitates the uptake of basic amino acids, imipenem, and gluconate across the outer membrane.Nucleotide sequence analysis revealed a 4-bp (AGTC) insertion in the oprD gene, resulting in a frameshift in the cognate open reading frame. These isolates became imipenem susceptible when the chromosomal oprD lesion was complemented, indicating that the 4-bp insertion in the oprD gene resulted in imipenem resistance.

References

Ref 1	Analysis of the Pseudomonas aeruginosa oprD gene from clinical and environmental isolates. Environ Microbiol. 2002 Dec;4(12):872-82. doi: 10.1046/j.1462-2920.2002.00281.x.
Ref 2	Genetic markers of widespread extensively drug-resistant Pseudomonas aeruginosa high-risk clones. Antimicrob Agents Chemother. 2012 Dec;56(12):6349-57. doi: 10.1128/AAC.01388-12. Epub 2012 Oct 8.
Ref 3	A novel Pseudomonas aeruginosa strain with an oprD mutation in relation to a nosocomial respiratory infection outbreak in an intensive care unit. J Clin Microbiol. 2014 Dec;52(12):4388-90. doi: 10.1128/JCM.02782-14. Epub 2014 Oct 8.