Molecule Information

General Information of the Molecule (ID: Mol00968)

• Name: Fur1 uracil phosphoribosyltransferase (FUR1) ,Candida auris
• Synonyms: QG37_00045
• Molecule Type: Protein
• Gene Name: QG37_00045
• Sequence:
  MSTPQNVSKNVILLPQTNQLRGLYSIIRDQLTKRGDFVFYSDRIIRLLVEEGLNQLPVEE
  AIIECHGGHKYKGAKFLGKICGVSIVRAGESMEMGLRDCCRSVRIGKILIQRDEETALPK
  LFYEKLPEDISERYVFLLDPMLATGGSAMMAVEVLLSRGVRMDRIFFLNLLAAPEGINAF
  HEKYPDVRIITGGIDEKLDDDKYIVPGLGDFGDRYYCI
• Uniprot ID: A0A0L0P8H5_CANAR

Kingdom: Fungi
Phylum: Ascomycota
Class: Saccharomycetes
Order: Saccharomycetales
Family: Metschnikowiaceae
Genus: .
Species: Candida auris

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Flucytosine

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Candida auris infection [1]

• Resistant Disease: Candida auris infection [ICD-11: 1F23.2]
• Resistant Drug: Flucytosine
• Molecule Alteration: Missense mutation; p.F211I
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Candida auris strain; 498019
• Experiment for Molecule Alteration: DNA sequencing assay
• Experiment for Drug Resistance: AFST assay
• Mechanism Description: One isolate displayed resistance to both echinocandins (micafungin, caspofungin, and anidulafungin) and 5-flucytosine; the former was associated with a serine to tyrosine amino acid substitution in the gene FkS1, and the latter was associated with a phenylalanine to isoleucine substitution in the gene FUR1.

References

• Ref 1: Genomic epidemiology of the UK outbreak of the emerging human fungal pathogen Candida auris. Emerg Microbes Infect. 2018 Mar 29;7(1):43. doi: 10.1038/s41426-018-0045-x.