Molecule Information

General Information of the Molecule (ID: Mol00926)

• Name: DNA topoisomerase (ATP-hydrolyzing) (PARC) ,Mycoplasma hominis
• Molecule Type: Protein
• Gene Name: parC
• Sequence:
  MKKDRKEEIQEVTENIIEKNMADIMSDRFGRYSKYIIQQRAIPDARDGLKPVQRRILYSM
  WNLHLKNSEPFKKSARIVGDVIGRYHPHGDSSIYEALVRMAQDWKSNFPLIEMHGNKGSI
  DDDPAAAMRYTESRLEKISELMLKDLDRKVVKMAPNFDDSEYEPIVLPALFPNLLVNGAK
  GIAAGFATEIPPHNLGEVIDATIALIKNPTISIEELSEIVKGPDFPTGAIINGINEIKKA
  LSSGQGRITISSKYHYVYDKKDESKIIGIEIIEIPFGVVKSKLVADIDAIAIDKKISGIK
  EVLDQTDRNGISIFIQLEDGANADAIIAYLMNKTELSISYSYNMVAIDNNRPVILNLYSA
  LIAYLSHLKEVNINGINYDLKKFKLRLEIVEGFIKVAEISDEVIHLIKESDNSKKGVILA
  LMNKFKFSELQATAIAELRLYKLSRMDQIEFQEEKKNLEIQIENCNKLLNDKWEFNQYLI
  KQLLEIKNQYSKPRLTEISDQKIDKEIDHKLLTKNEDFYLYITKDGYYKKISLKVYTSNE
  LSTFKLKEEDNVFYFDKVNSLSKILFFTNLGNYFIIDCHLFKDCNWKDLGQHISSIVALE
  SSEKIIRVIEITSFNNYANFILMSKLGYAKKVNLRDFENKSSLKTKTCMSFKDDNDELID
  AQISNDEKMLFILLNNGMYHLVSENELKVGISLKARGIRLLLNLYKHPQLQVSGFITVSK
  YNNIIYLTQGGYIKCWDTSKLESTTRNTPKMLFTPLKNNILGLQSLAVTLSNLKMLYTDN
  NGNLAEYDWKFILKDKTKESKLLKLDYSFTNPGYFITPIKINELIEVDEIEQEKIRQEYQ
  GYIDKNIELTAEHALIKKSYNQDIQHLNNEEQEELFQISTEDIELPNVSNNVNDNQKDKK
  NIATKESVSQKIQEIEKIDLETIMQKIKQIKKK
• Uniprot ID: O52166_MYCHO

Kingdom: N.A.
Phylum: Tenericutes
Class: .
Order: Mycoplasmoidales
Family: Metamycoplasmataceae
Genus: Metamycoplasma
Species: Metamycoplasma hominis

Type(s) of Resistant Mechanism of This Molecule

  EADR: Epigenetic Alteration of DNA, RNA or Protein

Drug Resistance Data Categorized by Drug

Approved Drug(s) 3 drug(s) in total

Levofloxacin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Epigenetic Alteration of DNA, RNA or Protein (EADR)

Disease Class: Mycoplasma hominis genital infection [1]

• Resistant Disease: Mycoplasma hominis genital infection [ICD-11: 1B2Z.7]
• Resistant Drug: Levofloxacin
• Molecule Alteration: Missense mutation; p.K134R
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Mycoplasma hominis ATCC 23114(PG21); 347256
• In Vitro Model: Mycoplasma hominis isolate; 2098
• Experiment for Molecule Alteration: Whole genome sequence assay
• Mechanism Description: The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV.

Disease Class: Mycoplasma hominis prostate cancer [1]

• Resistant Disease: Mycoplasma hominis prostate cancer [ICD-11: 2C82.Y]
• Resistant Drug: Levofloxacin
• Molecule Alteration: Missense mutation; p.K134R
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Mycoplasma hominis ATCC 23114(PG21); 347256
• In Vitro Model: Mycoplasma hominis isolate; 2098
• Experiment for Molecule Alteration: Whole genome sequence assay
• Mechanism Description: The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV.

Disease Class: Mycoplasma hominis mycoplasma infection [1]

• Resistant Disease: Mycoplasma hominis mycoplasma infection [ICD-11: 1B2Z.4]
• Resistant Drug: Levofloxacin
• Molecule Alteration: Missense mutation; p.K134R
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Mycoplasma hominis ATCC 23114(PG21); 347256
• In Vitro Model: Mycoplasma hominis isolate; 2098
• Experiment for Molecule Alteration: Whole genome sequence assay
• Mechanism Description: The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV.

Ofloxacin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Epigenetic Alteration of DNA, RNA or Protein (EADR)

Disease Class: Mycoplasma hominis genital infection [1]

• Resistant Disease: Mycoplasma hominis genital infection [ICD-11: 1B2Z.7]
• Resistant Drug: Ofloxacin
• Molecule Alteration: Missense mutation; p.K134R
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Mycoplasma hominis ATCC 23114(PG21); 347256
• In Vitro Model: Mycoplasma hominis isolate; 2098
• Experiment for Molecule Alteration: Whole genome sequence assay
• Mechanism Description: The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV.

Disease Class: Mycoplasma hominis prostate cancer [1]

• Resistant Disease: Mycoplasma hominis prostate cancer [ICD-11: 2C82.Y]
• Resistant Drug: Ofloxacin
• Molecule Alteration: Missense mutation; p.K134R
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Mycoplasma hominis ATCC 23114(PG21); 347256
• In Vitro Model: Mycoplasma hominis isolate; 2098
• Experiment for Molecule Alteration: Whole genome sequence assay
• Mechanism Description: The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV.

Disease Class: Mycoplasma hominis mycoplasma infection [1]

• Resistant Disease: Mycoplasma hominis mycoplasma infection [ICD-11: 1B2Z.4]
• Resistant Drug: Ofloxacin
• Molecule Alteration: Missense mutation; p.K134R
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Mycoplasma hominis ATCC 23114(PG21); 347256
• In Vitro Model: Mycoplasma hominis isolate; 2098
• Experiment for Molecule Alteration: Whole genome sequence assay
• Mechanism Description: The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV.

Sparfloxacin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Epigenetic Alteration of DNA, RNA or Protein (EADR)

Disease Class: Mycoplasma hominis genital infection [1]

• Resistant Disease: Mycoplasma hominis genital infection [ICD-11: 1B2Z.7]
• Resistant Drug: Sparfloxacin
• Molecule Alteration: Missense mutation; p.K134R
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Mycoplasma hominis ATCC 23114(PG21); 347256
• In Vitro Model: Mycoplasma hominis isolate; 2098
• Experiment for Molecule Alteration: Whole genome sequence assay
• Mechanism Description: The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV.

Disease Class: Mycoplasma hominis prostate cancer [1]

• Resistant Disease: Mycoplasma hominis prostate cancer [ICD-11: 2C82.Y]
• Resistant Drug: Sparfloxacin
• Molecule Alteration: Missense mutation; p.K134R
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Mycoplasma hominis ATCC 23114(PG21); 347256
• In Vitro Model: Mycoplasma hominis isolate; 2098
• Experiment for Molecule Alteration: Whole genome sequence assay
• Mechanism Description: The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV.

Disease Class: Mycoplasma hominis mycoplasma infection [1]

• Resistant Disease: Mycoplasma hominis mycoplasma infection [ICD-11: 1B2Z.4]
• Resistant Drug: Sparfloxacin
• Molecule Alteration: Missense mutation; p.K134R
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Mycoplasma hominis ATCC 23114(PG21); 347256
• In Vitro Model: Mycoplasma hominis isolate; 2098
• Experiment for Molecule Alteration: Whole genome sequence assay
• Mechanism Description: The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV.

References

• Ref 1: Molecular mechanism of fluoroquinolones resistance in Mycoplasma hominis clinical isolates. Braz J Microbiol. 2014 May 19;45(1):239-42. doi: 10.1590/s1517-83822014000100034. eCollection 2014.