Molecule Information
General Information of the Molecule (ID: Mol00926)
Name |
DNA topoisomerase (ATP-hydrolyzing) (PARC)
,Mycoplasma hominis
|
||||
---|---|---|---|---|---|
Molecule Type |
Protein
|
||||
Gene Name |
parC
|
||||
Sequence |
MKKDRKEEIQEVTENIIEKNMADIMSDRFGRYSKYIIQQRAIPDARDGLKPVQRRILYSM
WNLHLKNSEPFKKSARIVGDVIGRYHPHGDSSIYEALVRMAQDWKSNFPLIEMHGNKGSI DDDPAAAMRYTESRLEKISELMLKDLDRKVVKMAPNFDDSEYEPIVLPALFPNLLVNGAK GIAAGFATEIPPHNLGEVIDATIALIKNPTISIEELSEIVKGPDFPTGAIINGINEIKKA LSSGQGRITISSKYHYVYDKKDESKIIGIEIIEIPFGVVKSKLVADIDAIAIDKKISGIK EVLDQTDRNGISIFIQLEDGANADAIIAYLMNKTELSISYSYNMVAIDNNRPVILNLYSA LIAYLSHLKEVNINGINYDLKKFKLRLEIVEGFIKVAEISDEVIHLIKESDNSKKGVILA LMNKFKFSELQATAIAELRLYKLSRMDQIEFQEEKKNLEIQIENCNKLLNDKWEFNQYLI KQLLEIKNQYSKPRLTEISDQKIDKEIDHKLLTKNEDFYLYITKDGYYKKISLKVYTSNE LSTFKLKEEDNVFYFDKVNSLSKILFFTNLGNYFIIDCHLFKDCNWKDLGQHISSIVALE SSEKIIRVIEITSFNNYANFILMSKLGYAKKVNLRDFENKSSLKTKTCMSFKDDNDELID AQISNDEKMLFILLNNGMYHLVSENELKVGISLKARGIRLLLNLYKHPQLQVSGFITVSK YNNIIYLTQGGYIKCWDTSKLESTTRNTPKMLFTPLKNNILGLQSLAVTLSNLKMLYTDN NGNLAEYDWKFILKDKTKESKLLKLDYSFTNPGYFITPIKINELIEVDEIEQEKIRQEYQ GYIDKNIELTAEHALIKKSYNQDIQHLNNEEQEELFQISTEDIELPNVSNNVNDNQKDKK NIATKESVSQKIQEIEKIDLETIMQKIKQIKKK Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
EADR: Epigenetic Alteration of DNA, RNA or Protein
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Levofloxacin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Epigenetic Alteration of DNA, RNA or Protein (EADR) | ||||
Disease Class: Mycoplasma hominis genital infection | [1] | |||
Resistant Disease | Mycoplasma hominis genital infection [ICD-11: 1B2Z.7] | |||
Resistant Drug | Levofloxacin | |||
Molecule Alteration | Missense mutation | p.K134R |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycoplasma hominis ATCC 23114(PG21) | 347256 | ||
Mycoplasma hominis isolate | 2098 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Mechanism Description | The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV. | |||
Disease Class: Mycoplasma hominis prostate cancer | [1] | |||
Resistant Disease | Mycoplasma hominis prostate cancer [ICD-11: 2C82.Y] | |||
Resistant Drug | Levofloxacin | |||
Molecule Alteration | Missense mutation | p.K134R |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycoplasma hominis ATCC 23114(PG21) | 347256 | ||
Mycoplasma hominis isolate | 2098 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Mechanism Description | The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV. | |||
Disease Class: Mycoplasma hominis mycoplasma infection | [1] | |||
Resistant Disease | Mycoplasma hominis mycoplasma infection [ICD-11: 1B2Z.4] | |||
Resistant Drug | Levofloxacin | |||
Molecule Alteration | Missense mutation | p.K134R |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycoplasma hominis ATCC 23114(PG21) | 347256 | ||
Mycoplasma hominis isolate | 2098 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Mechanism Description | The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV. |
Ofloxacin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Epigenetic Alteration of DNA, RNA or Protein (EADR) | ||||
Disease Class: Mycoplasma hominis genital infection | [1] | |||
Resistant Disease | Mycoplasma hominis genital infection [ICD-11: 1B2Z.7] | |||
Resistant Drug | Ofloxacin | |||
Molecule Alteration | Missense mutation | p.K134R |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycoplasma hominis ATCC 23114(PG21) | 347256 | ||
Mycoplasma hominis isolate | 2098 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Mechanism Description | The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV. | |||
Disease Class: Mycoplasma hominis prostate cancer | [1] | |||
Resistant Disease | Mycoplasma hominis prostate cancer [ICD-11: 2C82.Y] | |||
Resistant Drug | Ofloxacin | |||
Molecule Alteration | Missense mutation | p.K134R |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycoplasma hominis ATCC 23114(PG21) | 347256 | ||
Mycoplasma hominis isolate | 2098 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Mechanism Description | The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV. | |||
Disease Class: Mycoplasma hominis mycoplasma infection | [1] | |||
Resistant Disease | Mycoplasma hominis mycoplasma infection [ICD-11: 1B2Z.4] | |||
Resistant Drug | Ofloxacin | |||
Molecule Alteration | Missense mutation | p.K134R |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycoplasma hominis ATCC 23114(PG21) | 347256 | ||
Mycoplasma hominis isolate | 2098 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Mechanism Description | The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV. |
Sparfloxacin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Epigenetic Alteration of DNA, RNA or Protein (EADR) | ||||
Disease Class: Mycoplasma hominis genital infection | [1] | |||
Resistant Disease | Mycoplasma hominis genital infection [ICD-11: 1B2Z.7] | |||
Resistant Drug | Sparfloxacin | |||
Molecule Alteration | Missense mutation | p.K134R |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycoplasma hominis ATCC 23114(PG21) | 347256 | ||
Mycoplasma hominis isolate | 2098 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Mechanism Description | The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV. | |||
Disease Class: Mycoplasma hominis prostate cancer | [1] | |||
Resistant Disease | Mycoplasma hominis prostate cancer [ICD-11: 2C82.Y] | |||
Resistant Drug | Sparfloxacin | |||
Molecule Alteration | Missense mutation | p.K134R |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycoplasma hominis ATCC 23114(PG21) | 347256 | ||
Mycoplasma hominis isolate | 2098 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Mechanism Description | The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV. | |||
Disease Class: Mycoplasma hominis mycoplasma infection | [1] | |||
Resistant Disease | Mycoplasma hominis mycoplasma infection [ICD-11: 1B2Z.4] | |||
Resistant Drug | Sparfloxacin | |||
Molecule Alteration | Missense mutation | p.K134R |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycoplasma hominis ATCC 23114(PG21) | 347256 | ||
Mycoplasma hominis isolate | 2098 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Mechanism Description | The single amino acid mutation in ParC of MH may relate to the resistance to OFX and LVX and the high-level resistance to fluoroquinolones for MH is associated with mutations in both DNA gyrase and the ParC subunit of topoisomerase IV. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.