Molecule Information

General Information of the Molecule (ID: Mol00895)

• Name: Dihydrofolate reductase (DHFR) ,Vibrio cholerae
• Synonyms: DHPS; Dihydropteroate pyrophosphorylase; folP; sul2; D6U24_19945; VC1786ICE_13; Vcrx029
• Molecule Type: Protein
• Gene Name: sulII
• Gene ID: 64223951
• Sequence:
  MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVIDLGPASSNPDAAPVS
  SDTEIARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAYLNDIRGFPDAAFYPQLAK
  SSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTGAGIKRNRLVLDPGMGFF
  LGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRALTGRGPGDVGAATLAAELAAAA
  GGADFIRTHEPRPLRDGLAVLAALKETARIR
• Function: Catalyzes the condensation of para-aminobenzoate (pABA) with 6-hydroxymethyl-7,8-dihydropterin diphosphate (DHPt-PP) to form 7,8-dihydropteroate (H2Pte), the immediate precursor of folate derivatives.
• Uniprot ID: Q7DFV9_VIBCL

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Vibrionales
Family: Vibrionaceae
Genus: Vibrio
Species: Vibrio cholerae

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Sulfamethoxazole

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Vibrio cholerae infection [1]

• Resistant Disease: Vibrio cholerae infection [ICD-11: 1A00.0]
• Resistant Drug: Sulfamethoxazole
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli DH5alpha; 668369
• In Vitro Model: Escherichia coli k-12 strain TOP10; 83333
• In Vitro Model: Vibrio cholerae O1 C10488; 127906
• In Vitro Model: Vibrio cholerae O1 strain CO943; 127906
• In Vitro Model: Vibrio cholerae O139 1811/98; 45888
• In Vitro Model: Vibrio cholerae O139 2055; 45888
• In Vitro Model: Vibrio cholerae O139 AS207; 45888
• In Vitro Model: Vibrio cholerae O139 E712; 45888
• In Vitro Model: Vibrio cholerae O139 HkO139-SXTS; 45888
• In Vitro Model: Vibrio cholerae O139 strain MO10; 345072
• Experiment for Molecule Alteration: Sequencing assay
• Mechanism Description: Many recent Asian clinical Vibrio cholerae E1 Tor O1 and O139 isolates are resistant to the antibiotics sulfamethoxazole (Su), trimethoprim (Tm), chloramphenicol (Cm), and streptomycin (Sm). The corresponding resistance genes are located on large conjugative elements (SXT constins) that are integrated into prfC on the V. cholerae chromosome. The DNA sequences of the antibiotic resistance genes in the SXT constin in MO10, an O139 isolate. In SXT(MO10), these genes are clustered within a composite transposon-like structure found near the element's 5' end. The genes conferring resistance to Cm (floR), Su (sulII), and Sm (strA and strB) correspond to previously described genes, whereas the gene conferring resistance to Tm, designated dfr18, is novel.

References

• Ref 1: Molecular analysis of antibiotic resistance gene clusters in vibrio cholerae O139 and O1 SXT constins. Antimicrob Agents Chemother. 2001 Nov;45(11):2991-3000. doi: 10.1128/AAC.45.11.2991-3000.2001.