General Information of the Molecule (ID: Mol00889)
Name
D-glucan-1,3-beta--UDP glucosyltransferase (FKS1) ,Candida glabrata
Synonyms
FKS2; AO440_003426; EC 2.4.1.34
    Click to Show/Hide
Molecule Type
Protein
Gene Name
FKS2
Sequence
MSYDQGGNGNWQNTDPNGNYYYNGAENNEFYDQDYASQQPEQQQGGEGYYDEYGQPNYNY
MNDPQQGQMPQQQPGGYDNDGYYDSYYNNQMNAGVGNGLGPDQTNFSDFSSYGPPPFQNN
QANYTPSQLSYSNNGMGSNGMNMSGSSTPVYGNYDPNAIAMTLPNDPYPAWTADPQSPVS
IEQIEDVFIDLTNKFGFQRDSMRNIFDLFMTLLDSRTSRMSPDQALLSVHADYIGGDTAN
YKKWYFAAQLDMDDEVGFRNMNLGKLSRKARKAKKKNKKAMEEANPEDAAEVLNKIEGDN
SLEASDFRWKTKMNMLTPIERVRQVALYMLIWGEANQVRFTSECLCFIYKCASDYLESPL
CQQRTEPIPEGDYLNRVITPIYQFIRNQVYEIVDGRYVKREKDHNKIIGYDDVNQLFWYP
EGITKIVLEDGTKLTDIPSEERYLRLGEVAWNDVFFKTYKETRTWLHLVTNFNRIWIMHV
SVYWMYVAYNSPTFYTHNYQQLVNNQPVPAYRWASAALAGTVASAIQLFATVCEWWFVPR
KWAGAQHLSRRFWFLCGILGVNLGPLIFVFAYEKDTVQSKAGHAVAAVTFFIAVATVLFF
SIMPLGGLFTSYMQKSSRRYVASQTFTASFAPLQGLDRWLSYLVWVTVFAAKYSESYFFL
ILSLRDPIRILSTTTMRCTGEYWWGSKLCRHQSKIVLGFMIATDFILFFLDTYLWYIVVN
TVFSVGKSFYLGISILTPWRNIFTRLPKRIYSKILATTDMEIKYKPKVLISQIWNAIIIS
MYREHLLAIDHVQKLLYHQVPSEIEGKRTLRAPTFFVSQDDNNFETEFFPRNSEAERRIS
FFAQSLATPMPEPLPVDNMPTFTVLTPHYSERILLSLREIIREDDQFSRVTLLEYLKQLH
PVEWECFVKDTKILAEETAAYENEEPQDPEKSDALKTQIDDLPFYCIGFKSAAPEYTLRT
RIWASLRSQTLYRTVSGFMNYARAIKLLYRVENPEIVQMFGGNAEGLERELEKMARRKFK
FLVSMQRLAKFKPHELENTEFLLRAYPDLQIAYLDEEPPLNEGEEPRIYSALIDGHCEML
ENGRRRPKFRVQLSGNPILGDGKSDNQNHALIFYRGEYIQLIDANQDNYLEECLKIRSVL
AEFEELNAEPVYPYTPGVKYEDQKTNHPVAIVGAREYIFSENSGVLGDVAAGKEQTFGTL
FARTLAQIGGKLHYGHPDFINATFMTTRSGLSKAQKGLHLNEDIYAGMNALLRGGRIKHC
EYYQCGKGRDLGFGTILNFTTKIGAGMGEQMLSREYYYLGTQLPVDRFLTFYYAHPGFHL
NNLFIQLSLQMFMLTLVNLHALAHESILCIYDRNKPKTDVLYPIGCYNFSPAIDWIRRYT
LSIFIVFWIAFVPIVVQELIERGLWKATQRFFRHILSLSPMFEVFAGQIYSAALLSDMTV
GGARYISTGRGFATSRIPFSILYSRFASSAIYMGARSMLMLLFGTVAHWQAPLLWFWASL
SALLFSPFIFNPHQFSWEDFFLDYRDYIRWLSRGNNKYHKNSWIGYVRMARSRITGFKRK
LIGDDSEKAAGDANRAHRTNLILAELIPTAINAGSCFIGFTFINAQTGVKATDDDRVNSV
LRVVLCTLGPIAVDVGVLFFCLGMSCCSGPLFGMCCKKTGAVMAAVAHGVSVVIHIGFFI
VMWVLEGFNFTRMLVGVATVIQCQRFIFQLMTILLLTREFKNDHANTAFWTGKWYGSGFG
YMAWTQPMRELTAKVIEMSEFAADFVLGHVILFAQFPVLCIPAIDKFHSIMLFWLKPSRH
IRPPIYSLKQSRLRKRMVKRYLTLYIIIFLVFAGAIVGPAVAASHVPQDIGHTLTGPFHN
IVQPRNKSNNDTGLQISTYSNHYYTHTPSLKTWSTIK
    Click to Show/Hide
Uniprot ID
F5BCZ9_CANGB
        Click to Show/Hide the Complete Species Lineage
Kingdom: Fungi
Phylum: Ascomycota
Class: Saccharomycetes
Order: Saccharomycetales
Family: Saccharomycetaceae
Genus: Nakaseomyces
Species: Candida glabrata
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Click to Show/Hide the Full List of Drugs
Anidulafungin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Candida glabrata infection [1]
Resistant Disease Candida glabrata infection [ICD-11: 1F23.3]
Resistant Drug Anidulafungin
Molecule Alteration Missense mutation
p.F659V (c.T1975G)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida glabrata strain 5478
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
NCCLS method M-27A with broth macrodilution techniques assay
Mechanism Description Recently, three reports showed that amino acid substitutions in Fks1p (D632E) and Fks2p (F659V) are responsible for clinical echinocandin resistance in C. glabrata.
Disease Class: Candida glabrata infection [1]
Resistant Disease Candida glabrata infection [ICD-11: 1F23.3]
Resistant Drug Anidulafungin
Molecule Alteration Missense mutation
p.F659S(c.T1976C)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida glabrata strain 5478
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
NCCLS method M-27A with broth macrodilution techniques assay
Mechanism Description Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata.
Disease Class: Candida glabrata infection [1]
Resistant Disease Candida glabrata infection [ICD-11: 1F23.3]
Resistant Drug Anidulafungin
Molecule Alteration Frameshift mutation
p.F659del(c.1974-CTT-1976)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida glabrata strain 5478
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
NCCLS method M-27A with broth macrodilution techniques assay
Mechanism Description Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata.
Disease Class: Candida glabrata infection [1]
Resistant Disease Candida glabrata infection [ICD-11: 1F23.3]
Resistant Drug Anidulafungin
Molecule Alteration Nonsense mutation
p.R1377STOP (c.A4129T)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida glabrata strain 5478
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
NCCLS method M-27A with broth macrodilution techniques assay
Mechanism Description Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata.
Caspofungin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Candida glabrata infection [1]
Resistant Disease Candida glabrata infection [ICD-11: 1F23.3]
Resistant Drug Caspofungin
Molecule Alteration Missense mutation
p.F659V (c.T1975G)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida glabrata strain 5478
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
NCCLS method M-27A with broth macrodilution techniques assay
Mechanism Description Recently, three reports showed that amino acid substitutions in Fks1p (D632E) and Fks2p (F659V) are responsible for clinical echinocandin resistance in C. glabrata.
Disease Class: Candida glabrata infection [1]
Resistant Disease Candida glabrata infection [ICD-11: 1F23.3]
Resistant Drug Caspofungin
Molecule Alteration Missense mutation
p.F659S (c.T1976C)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida glabrata strain 5478
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
NCCLS method M-27A with broth macrodilution techniques assay
Mechanism Description Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata.
Disease Class: Candida glabrata infection [1]
Resistant Disease Candida glabrata infection [ICD-11: 1F23.3]
Resistant Drug Caspofungin
Molecule Alteration Missense mutation
p.F659del (c.1974-CTT-1976)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida glabrata strain 5478
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
NCCLS method M-27A with broth macrodilution techniques assay
Mechanism Description Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata.
Disease Class: Candida glabrata infection [1]
Resistant Disease Candida glabrata infection [ICD-11: 1F23.3]
Resistant Drug Caspofungin
Molecule Alteration Nonsense mutation
p.R1377STOP (c.A4129T)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida glabrata strain 5478
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
NCCLS method M-27A with broth macrodilution techniques assay
Mechanism Description Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata.
Micafungin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Candida glabrata infection [1]
Resistant Disease Candida glabrata infection [ICD-11: 1F23.3]
Resistant Drug Micafungin
Molecule Alteration Missense mutation
p.F659V (c.T1975G)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida glabrata strain 5478
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
NCCLS method M-27A with broth macrodilution techniques assay
Mechanism Description Recently, three reports showed that amino acid substitutions in Fks1p (D632E) and Fks2p (F659V) are responsible for clinical echinocandin resistance in C. glabrata.
Disease Class: Candida glabrata infection [1]
Resistant Disease Candida glabrata infection [ICD-11: 1F23.3]
Resistant Drug Micafungin
Molecule Alteration Missense mutation
p.F659S (c.T1976C)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida glabrata strain 5478
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
NCCLS method M-27A with broth macrodilution techniques assay
Mechanism Description Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata.
Disease Class: Candida glabrata infection [1]
Resistant Disease Candida glabrata infection [ICD-11: 1F23.3]
Resistant Drug Micafungin
Molecule Alteration Frameshift mutation
p.F659del (c.1974-CTT-1976)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida glabrata strain 5478
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
NCCLS method M-27A with broth macrodilution techniques assay
Mechanism Description Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata.
Disease Class: Candida glabrata infection [1]
Resistant Disease Candida glabrata infection [ICD-11: 1F23.3]
Resistant Drug Micafungin
Molecule Alteration Nonsense mutation
p.R1377STOP (c.A4129T)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Candida glabrata strain 5478
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
NCCLS method M-27A with broth macrodilution techniques assay
Mechanism Description Fks1p and Fks2p amino acid substitutions confer reduced echinocandin susceptibility in C. glabrata.
References
Ref 1 Effect of Candida glabrata FKS1 and FKS2 mutations on echinocandin sensitivity and kinetics of 1,3-beta-D-glucan synthase: implication for the existing susceptibility breakpoint. Antimicrob Agents Chemother. 2009 Sep;53(9):3690-9. doi: 10.1128/AAC.00443-09. Epub 2009 Jun 22.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.