Molecule Information

General Information of the Molecule (ID: Mol00808)

Name	ATP-binding protein (ABP) ,Streptomyces antibioticus
Synonyms	oleC-ORF4; ATP-binding protein Click to Show/Hide
Molecule Type	Protein
Gene Name	oleC-ORF4
Sequence	MTVRGLVKHYGETKALDGVDLDVREGTVMGVLGPNGAGKTTLVRILSTLITPDSGQATVA GYDVVRQPRQLRRVIGLTGQYASVDEKLPGWENLYLIGRLLDLSRKEARARADELLERFS LTEAARRPAGTYSGGMRRRLDLAASMIGRPAVLYLDEPTTGLDPRTRNEVWDEVKAMVGD GVTVLLTTQYMEEAEQLASELTVVDRGRVIAKGGIEELKARVGGRTLRVRPVDPLQLRPL AGMLDELGITGLASTTVDTETGALLVPILSDEQLTAVVGAVTARGITLSSITTELPSLDE VFLSLTGHRASAPQDAEPARQEVAV Click to Show/Hide
Uniprot ID	Q53716_STRAT
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Actinobacteria Class: Actinomycetia Order: Streptomycetales Family: Streptomycetaceae Genus: Streptomyces Species: Streptomyces antibioticus

Type(s) of Resistant Mechanism of This Molecule

IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Matromycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Streptomyces antibioticus infection			[1]
Resistant Disease	Streptomyces antibioticus infection [ICD-11: 1C43.1]		Disease Info
Resistant Drug	Matromycin		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Streptomyces albus J1074		457425
	Streptomyces lividans strain Tk21		1916
	Escherichia coli strain ED8767		562
	Escherichia coli strain TGI		83333
	Streptomyces antibioticu strain ATCC 11891		1890
Experiment for Molecule Alteration	DNA hybridizations assay
Mechanism Description	Three different DNA fragments of an oleandomycin producer, Streptomyces antibioticus, conferring oleandomycin resistance were cloned in plasmid pIJ702 and expressed in Streptomyces lividans and in Streptomyces albus. These oleandomycin resistance determinants were designated as oleA (pOR400), oleB (pOR501) and oleC (pOR800). The oleC (orf4) gene product had a hydrophilic profile and showed important similarity with proteins containing typical ATP-binding domains characteristic of the ABC-transporter superfamily and involved in membrane transport and, particularly, with several genes conferring resistance to various macrolide antibiotics and anticancer drugs.

References

Ref 1	Streptomyces antibioticus contains at least three oleandomycin-resistance determinants, one of which shows similarity with proteins of the ABC-transporter superfamily. Mol Microbiol. 1993 May;8(3):571-82. doi: 10.1111/j.1365-2958.1993.tb01601.x.