Molecule Information

General Information of the Molecule (ID: Mol00795)

• Name: Aminoglycoside N(3)-acetyltransferase (A3AC) ,Streptomyces griseus
• Synonyms: yokD_2; NCTC13033_06639
• Molecule Type: Protein
• Gene Name: kan
• Gene ID: 6215660
• Sequence:
  MDETELLRRSDGPVTRDRIRHDLAALGLVPGDTVMFHTRLSAIGYVSGGPQTVIDALLDV
  VGPTGTLLVTCGWNDAPPYDFTDWPPAWQEAVRAHHPAFDPRTSEAEHANGRLPEALRRR
  PGAVRSRHPDVSLAALGASAPALMDAHPWDDPHGPGSPLARLVALGGRVLLLGAPRDTMT
  LLHHAEALAQAPGKRFVTYEQPIEVAGERVWRTFRDIDSEHGAFDYSSAVPEGQDPFAVI
  VGSMLAAGIGREGFVGAARSRLFDAAPAVEFGVRWIEEHLNRDR
• Uniprot ID: Q54216_STRGR

Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Streptomycetales
Family: Streptomycetaceae
Genus: Streptomyces
Species: Streptomyces griseus

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Kanamycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Streptomyces griseus infection [1]

• Resistant Disease: Streptomyces griseus infection [ICD-11: 1C43.7]
• Resistant Drug: Kanamycin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Streptomyces griseus strain SS-1198; 1911
• In Vitro Model: Streptomyces lividans strain Tk21; 1916
• In Vitro Model: Streptomyces lividans strain pIJ702; 1916
• Experiment for Molecule Alteration: RT-PCR
• Experiment for Drug Resistance: Maximum growth allowance concentrations assay
• Mechanism Description: We determined the molecular basis for the enhanced expression of the aac(3)-Xa gene encoding an aminoglycoside 3-N-acetyltransferase in Streptomyces griseus. A C-->T substitution was identified at the putative promoter of the mutant gene. RNA analyses demonstrated that the substitution caused a marked increase in the production of the gene-specific transcripts. Therefore, it seemed very likely that the aac(3)-Xa gene was activated by the substitution resulting in the emergence of a stronger promoter.

Disease Class: Streptomyces lividans infection [1]

• Resistant Disease: Streptomyces lividans infection [ICD-11: 1C43.8]
• Resistant Drug: Kanamycin
• Molecule Alteration: Expression; Acquired
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Streptomyces griseus strain SS-1198; 1911
• In Vitro Model: Streptomyces lividans strain Tk21; 1916
• In Vitro Model: Streptomyces lividans strain pIJ702; 1916
• Experiment for Molecule Alteration: RT-PCR
• Experiment for Drug Resistance: Maximum growth allowance concentrations assay
• Mechanism Description: After the insertion of these fragments into pIJ702 with all possible combinations, the hybrid genes were tested for their ability to confer km resistance to S. lividans Tk21. A high level (1,000 ug/ml) of km resistance was obtained only with genes containing the 0.5-kb BglII-BamHI fragment derived from the mutant gene. By contrast, genes containing the 0.5-kb fragment from the wild-type gene conferred resistance to km at concentrations as low as 50 ug/ml.

References

• Ref 1: Identification and characterization of the point mutation which affects the transcription level of the chromosomal 3-N-acetyltransferase gene of Streptomyces griseus SS-1198. Antimicrob Agents Chemother. 2000 Feb;44(2):437-40. doi: 10.1128/AAC.44.2.437-440.2000.