Molecule Information

General Information of the Molecule (ID: Mol00794)

Name	Aminoglycoside adenylyltransferase (AAD5) ,Escherichia coli
Synonyms	aadA5; Aminoglycoside adenylyltransferase Click to Show/Hide
Molecule Type	Protein
Gene Name	aadA5
Sequence	MLDLLKVSSPPGDGGTWRPLELTVVARSEVVPWRYPARRELQFGEWLRHDILSGTFEPAV LDHDLAILLTKARQHSLALLGPSAATFFEPVPKEHFSKALFDTIAQWNAESDWKGDERNV VLALARIWYSASTGLIAPKDVAAAWVSERLPAEHRPLICKARAAYLGSEDDDLAMRVEET AAFVRYAKATIERILRCAARAASASTPWRGHRSHRSAFKRRGSAVRSNMS Click to Show/Hide
Uniprot ID	A0A896ZCC3_ECOLX
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Escherichia Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

2 drug(s) in total

Click to Show/Hide the Full List of Drugs

Spectinomycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Escherichia coli infection			[1]
Resistant Disease	Escherichia coli infection [ICD-11: 1A03.0]		Disease Info
Resistant Drug	Spectinomycin		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli strain 9516014-1		562
	Escherichia coli strain k-12 J62-2		83333
	Salmonella enterica serotype Typhimurium DT104 no. 9720921		90371
Experiment for Molecule Alteration	Sequencing with the QIAquick purification kit assay
Experiment for Drug Resistance	Sensititre system assay
Mechanism Description	The aadA genes are the only characterized genes that encode both streptomycin and spectinomycin resistance, and many of these genes are found as gene cassettes.

Streptomycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Escherichia coli infection			[1]
Resistant Disease	Escherichia coli infection [ICD-11: 1A03.0]		Disease Info
Resistant Drug	Streptomycin		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli strain 9516014-1		562
	Escherichia coli strain k-12 J62-2		83333
	Salmonella enterica serotype Typhimurium DT104 no. 9720921		90371
Experiment for Molecule Alteration	Sequencing with the QIAquick purification kit assay
Experiment for Drug Resistance	Sensititre system assay
Mechanism Description	The aadA genes are the only characterized genes that encode both streptomycin and spectinomycin resistance, and many of these genes are found as gene cassettes.

References

Ref 1	Novel streptomycin and spectinomycin resistance gene as a gene cassette within a class 1 integron isolated from Escherichia coli. Antimicrob Agents Chemother. 1999 Dec;43(12):3036-8. doi: 10.1128/AAC.43.12.3036.