General Information of the Molecule (ID: Mol00790)
Name
Aminoglycoside 6-adenylyltransferase (A6AD) ,Bacillus subtilis
Synonyms
6-O-adenyl-transferase; AAD(6); ANT(6); Aminoglycoside inactivating enzyme; Sm inactivating enzyme; Streptomycin 6-adenylyltransferase; BSU26790; HIR78_15755
    Click to Show/Hide
Molecule Type
Protein
Gene Name
aadK
Gene ID
938061
Sequence
MRSEQEMMDIFLDFALNDERIRLVTLEGSRTNRNIPPDNFQDYDISYFVTDVESFKENDQ
WLEIFGKRIMMQKPEDMELFPPELGNWFSYIILFEDGNKLDLTLIPIREAEDYFANNDGL
VKVLLDKDSFINYKVTPNDRQYWIKRPTAREFDDCCNEFWMVSTYVVKGLARNEILFAID
HLNEIVRPNLLRMMAWHIASQKGYSFSMGKNYKFMKRYLSNKEWEELMSTYSVNGYQEMW
KSLFTCYALFRKYSKAVSEGLAYKYPDYDEGITKYTEGIYCSVK
    Click to Show/Hide
Function
Mediates bacterial resistance to streptomycin. Adenylates streptomycin on the O-6 residue. Adenylates streptidine on the O-6 residue. Does not act on spectinomycin, neomycin-B or kanamycin (Ref.5984036). Specific for ATP and GTP nucleotides incorporating a purine ring. No reaction with CTP or UTP.
    Click to Show/Hide
Uniprot ID
AADK_BACSU
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Bacillales
Family: Bacillaceae
Genus: Bacillus
Species: Bacillus subtilis
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Streptomycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Streptomycin
Molecule Alteration Expression
Up-regulation
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Bacillus subtilis strain 168 1423
Bacillus subtilis strain 169 1423
Bacillus subtilis strain 170 1423
Bacillus subtilis strain 171 1423
Bacillus subtilis strain 172 1423
Bacillus subtilis strain 173 1423
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description B. subtilis 168 produce s a chromosomally encoded aminoglycoside 6-adenylyltransferase, AAD(6),which inactivates S M by adenylation at the C-6 position of streptomycin.
References
Ref 1 Nucleotide sequence of the chromosomal gene coding for the aminoglycoside 6-adenylyltransferase from Bacillus subtilis Marburg 168. Gene. 1989 May 30;78(2):377-8. doi: 10.1016/0378-1119(89)90241-2.
Ref 2 Genetic mapping in Bacillus subtilis 168 of the aadK gene which encodes aminoglycoside 6-adenylyltransferase. FEMS Microbiol Lett. 1993 Nov 15;114(1):47-52. doi: 10.1016/0378-1097(93)90140-w.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.