Molecule Information

General Information of the Molecule (ID: Mol00777)

Name	Aminoglycoside (3'') (9) adenylyltransferase (AADA) ,Escherichia coli
Synonyms	aadA; aadA1; aadA2a; aadA_2; ant1_1; ant1_2; AOY10_00066; BANRA_05017; BANRA_05549; BGZ_05257; BGZ_05467; ExPECSC038_05202; JFD_05362; NDM1Dok01_N0149; SAMEA3472044_03633; SAMEA3472056_05572; SAMEA3472080_04508; TUM18780_18820 Click to Show/Hide
Molecule Type	Protein
Gene Name	aadA2
Sequence	MTIEISNQLSEVLSVIERHLESTLLAVHLYGSAVDGGLKPYSDIDLLVTVAVKLDETTRR ALLNDLMEASAFPGESETLRAIEVTLVVHDDIIPWRYPAKRELQFGEWQRNDILAGIFEP AMIDIDLAILLTKAREHSVALVGPAAEEFFDPVPEQDLFEALRETLKLWNSQPDWAGDER NVVLTLSRIWYSAITGKIAPKDVAADWAIKRLPAQYQPVLLEAKQAYLGQKEDHLASRAD HLEEFIRFVKGEIIKSVGK Click to Show/Hide
Uniprot ID	Q51348_ECOLX
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Escherichia Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Streptomycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Escherichia coli infection			[1]
Resistant Disease	Escherichia coli infection [ICD-11: 1A03.0]		Disease Info
Resistant Drug	Streptomycin		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli Co227		562
	Escherichia coli Co228		562
	Escherichia coli Co232		562
	Escherichia coli Co354		562
Experiment for Molecule Alteration	PCR; PCR-restriction fragment length polymorphism analysis; Sequencing assay
Experiment for Drug Resistance	Agar dilution method assay
Mechanism Description	Multiple-antibiotic-resistant phenotype is associated with gene mutation and mar locus regulation.

References

Ref 1	Mechanisms of resistance in multiple-antibiotic-resistant Escherichia coli strains of human, animal, and food origins. Antimicrob Agents Chemother. 2004 Oct;48(10):3996-4001. doi: 10.1128/AAC.48.10.3996-4001.2004.