Molecule Information

General Information of the Molecule (ID: Mol00776)

• Name: Aminoglycoside (3'') (9) adenylyltransferase (AADA) ,Pasteurella multocida
• Molecule Type: Protein
• Gene Name: aadA14
• Sequence:
  MTNKPPESIAEQVSEARSILENHLETIQAIHLFGSAVDGGLKPFSDIDLLVTVGTPLNES
  TRAALMSDLLAVSAFPGTDSKRRALEVTVLTQEDVVPWRYPAKRQMQFGEWLRDDINARI
  FEPALMDHDLAILLTKVRRHSVALYGPAAHEFFDEIPVVDVQRSLLETLTLWTTEADWKG
  DERNIVLALVRIWYTAMTGEITSKVAAADWALQRLPREIKSVVIAARDAYLGLEAADLAA
  YPKERADLRNHIHSSVTAKLQ
• Uniprot ID: Q5DUB9_PASMD

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Pasteurellales
Family: Pasteurellaceae
Genus: Pasteurella
Species: Pasteurella multocida

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Spectinomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Pasteurella multocida infection [1]

• Resistant Disease: Pasteurella multocida infection [ICD-11: 1B99.0]
• Resistant Drug: Spectinomycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli JM109 cells; 562
• Experiment for Molecule Alteration: PCR amplification and DNA sequence assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: AadA14 is the fifth reading frame in pCCk647 coded for a (3")(9) adenylyltransferase of 261 amino acids. The emergence of aada14 leads to drug resistance.

Disease Class: Mannheimia haemolytica infection [1]

• Resistant Disease: Mannheimia haemolytica infection [ICD-11: CA45.3]
• Resistant Drug: Spectinomycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli JM109 cells; 562
• Experiment for Molecule Alteration: PCR amplification and DNA sequence assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: AadA14 is the fifth reading frame in pCCk647 coded for a (3")(9) adenylyltransferase of 261 amino acids. The emergence of aada14 leads to drug resistance.

Disease Class: Histophilus somni infection [1]

• Resistant Disease: Histophilus somni infection [ICD-11: CA45.2]
• Resistant Drug: Spectinomycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli JM109 cells; 562
• Experiment for Molecule Alteration: PCR amplification and DNA sequence assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: AadA14 is the fifth reading frame in pCCk647 coded for a (3")(9) adenylyltransferase of 261 amino acids. The emergence of aada14 leads to drug resistance.

Streptomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Pasteurella multocida infection [1]

• Resistant Disease: Pasteurella multocida infection [ICD-11: 1B99.0]
• Resistant Drug: Streptomycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli JM109 cells; 562
• Experiment for Molecule Alteration: PCR amplification and DNA sequence assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: AadA14 is the fifth reading frame in pCCk647 coded for a (3")(9) adenylyltransferase of 261 amino acids. The emergence of aada14 leads to drug resistance.

Disease Class: Mannheimia haemolytica infection [1]

• Resistant Disease: Mannheimia haemolytica infection [ICD-11: CA45.3]
• Resistant Drug: Streptomycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli JM109 cells; 562
• Experiment for Molecule Alteration: PCR amplification and DNA sequence assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: AadA14 is the fifth reading frame in pCCk647 coded for a (3")(9) adenylyltransferase of 261 amino acids. The emergence of aada14 leads to drug resistance.

Disease Class: Histophilus somni infection [1]

• Resistant Disease: Histophilus somni infection [ICD-11: CA45.2]
• Resistant Drug: Streptomycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli JM109 cells; 562
• Experiment for Molecule Alteration: PCR amplification and DNA sequence assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: AadA14 is the fifth reading frame in pCCk647 coded for a (3")(9) adenylyltransferase of 261 amino acids. The emergence of aada14 leads to drug resistance.

References

• Ref 1: Novel spectinomycin/streptomycin resistance gene, aadA14, from Pasteurella multocida. Antimicrob Agents Chemother. 2005 Jul;49(7):3046-9. doi: 10.1128/AAC.49.7.3046-3049.2005.