Molecule Information

General Information of the Molecule (ID: Mol00761)

• Name: ABC transporter (ABCT) ,Plasmodium falciparum
• Synonyms: pgh1; Fragment
• Molecule Type: Protein
• Gene Name: pgh1
• Sequence:
  MHTVINYGLEDYFCNLIEKAIDYKNKGQKRRIIVNAALWGFSQSAQLFINSLAYWFGSFL
  IKRGTILVDDFMKSLFTFIFTGSYAGKLMSLKGDSENAKLSFEKYYPLMIRKSNIDVRDD
  GGIRINKNLIKGKVDIKDVNFRYISRPNVPIYKNLSFTCDSKKTTAIVGETGSGKSTFMN
  LLLRFYDLKNDHIILKNDMTNFQDYQNNNNNSLVLKNVNEFSNQSGSAEDYTVFNNNGEI
  LLDDINICDYNLRDLRNLFSIVSQ
• Uniprot ID: G3LT32_PLAFA

Kingdom: N.A.
Phylum: Apicomplexa
Class: Aconoidasida
Order: Haemosporida
Family: Plasmodiidae
Genus: Plasmodium
Species: Plasmodium falciparum

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Chloroquine

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Malaria [1]

• Sensitive Disease: Malaria [ICD-11: 1F45.0]
• Sensitive Drug: Chloroquine
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Plasmodium falciparum strains; 5833
• Mechanism Description: Phenothiazine drugs (chlor-promazine, trifluoperazine, prochlorperazine, methotrime-prazin or fluphenazin) can enhance in vitro the potency of CQ against P. falciparum CQ-resistant strains. phenothiazines may exert their CQ resistance reversal activity by interacting with Pgh1. Combinations of chlorpromazine or prochlorperazine with CQ confirm the reversal effect of these drugs on the CQ resistance as showed by cures obtained in Aotus monkeys infected with CQ-resistant P. falciparum.

References

• Ref 1: Inhibition of efflux of quinolines as new therapeutic strategy in malaria. Curr Top Med Chem. 2008;8(7):563-78. doi: 10.2174/156802608783955593.