Molecule Information

General Information of the Molecule (ID: Mol00756)

Name	30S ribosomal protein S12 (RPSL) ,Mycobacterium tuberculosis
Synonyms	rps12; Rv0682; MTV040.10 Click to Show/Hide
Molecule Type	Protein
Gene Name	rpsL
Gene ID	45424644
Sequence	MPTIQQLVRKGRRDKISKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSQ VEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAK KEKG Click to Show/Hide
Function	Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit (By similarity). Click to Show/Hide
Uniprot ID	RS12_MYCTU
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Actinobacteria Class: Actinomycetia Order: Corynebacteriales Family: Mycobacteriaceae Genus: Mycobacterium Species: Mycobacterium tuberculosis

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Streptomycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: HIV-infected patients with tuberculosis			[1], [2], [3]
Resistant Disease	HIV-infected patients with tuberculosis [ICD-11: 1C60.0]		Disease Info
Resistant Drug	Streptomycin		Drug Info
Molecule Alteration	Mutantion	p.K43R+p.K88Q+p.K88R
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Mycobacterium tuberculosis strain		1773
Experiment for Molecule Alteration	Whole genome sequence assay
Mechanism Description	Mycobacterium tuberculosis is associated either with missense mutations in the rpsL gene, which encodes ribosomal protein S12, or with base substitutions at position 904 in the 16S rRNA.Streptomycin resistant isolates harbored mutations in rpsL (codons k43R, k88Q, k88R) and rrs (nucleotide A514C).

References

Ref 1	Molecular characterisation of streptomycin-resistant Mycobacterium tuberculosis strains isolated in Poland. Int J Tuberc Lung Dis. 2004 Aug;8(8):1032-5.
Ref 2	Loss of a conserved 7-methylguanosine modification in 16S rRNA confers low-level streptomycin resistance in bacteria. Mol Microbiol. 2007 Feb;63(4):1096-106. doi: 10.1111/j.1365-2958.2006.05585.x.
Ref 3	Drug resistance-conferring mutations in Mycobacterium tuberculosis from Madang, Papua New Guinea. BMC Microbiol. 2012 Sep 4;12:191. doi: 10.1186/1471-2180-12-191.