Molecule Information

General Information of the Molecule (ID: Mol00755)

• Name: 23S rRNA (adenosine(1067)-2'-O)-methyltransferase (TSNR) ,Streptomyces azureus
• Synonyms: 23S rRNA [AM1067] 2'-O-methyltransferase; 23S rRNA methylase; Thiostrepton-resistance methylase; rRNA (adenosine-2'-O)-methyltransferase; tsr
• Molecule Type: Protein
• Gene Name: tsnR
• Sequence:
  MTELDTIANPSDPAVQRIIDVTKPSRSNIKTTLIEDVEPLMHSIAAGVEFIEVYGSDSSP
  FPSELLDLCGRQNIPVRLIDSSIVNQLFKGERKAKTFGIARVPRPARFGDIASRRGDVVV
  LDGVKIVGNIGAIVRTSLALGASGIILVDSDITSIADRRLQRASRGYVFSLPVVLSGREE
  AIAFIRDSGMQLMTLKADGDISVKELGDNPDRLALLFGSEKGGPSDLFEEASSASVSIPM
  MSQTESLNVSVSLGIALHERIDRNLAANR
• Function: Specifically methylates the adenosine-1067 in 23S ribosomal RNA. Confers resistance to antibiotic thiostrepton.
• Uniprot ID: TSNR_STRAJ

Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Streptomycetales
Family: Streptomycetaceae
Genus: Streptomyces
Species: Streptomyces azureus

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Clinical Trial Drug(s) 1 drug(s) in total

Thiostrepton

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Streptomyces azureus infection [1]

• Resistant Disease: Streptomyces azureus infection [ICD-11: 1C43.4]
• Resistant Drug: Thiostrepton
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli JM109; 562
• In Vitro Model: Escherichia coli strain ED8767; 562
• In Vitro Model: Streptomyces lividans strain M252; 1916
• In Vitro Model: Streptomyces lividans strain 66; 1200984
• In Vitro Model: Escherichia coli strain W5445; 562
• In Vitro Model: Streptomyces lividans strain M264; 1916
• In Vitro Model: Streptomyces lividans strain M274; 1916
• Experiment for Molecule Alteration: DNA sequencing assay
• Mechanism Description: Promoter-probe plasmid vectors were used to isolate putative promoter-containing DNA fragments of three Streptomyces antibiotic resistance genes, the rRNA methylase (tsr) gene of S. azureus, the aminoglycoside phosphotransferase (aph) gene of S. fradiae, and the viomycin phosphotransferase (vph) gene of S. vinaceus. The rRNA methylase (tsr) gene of S. azureus, which confers resistance to thiostrepton by methylation of 23S rRNA.

References

• Ref 1: Nucleotide sequences encoding and promoting expression of three antibiotic resistance genes indigenous to Streptomyces. Mol Gen Genet. 1985;199(1):26-36. doi: 10.1007/BF00327505.