Molecule Information

General Information of the Molecule (ID: Mol00754)

• Name: 23S rRNA (adenosine(1067)-2'-O)-methyltransferase (TSNR) ,Streptomyces laurentii
• Synonyms: 23S rRNA [AM1067] 2'-O-methyltransferase; 23S rRNA methylase; Thiostrepton-resistance methylase; rRNA (adenosine-2'-O)-methyltransferase
• Molecule Type: Protein
• Gene Name: tsnR
• Sequence:
  MANLDVIVDRSDPAVQRIVDVTKHSRSVVRTVLIEDIEPLTQSIRAGVEFTEVYGLDTVP
  FPGDLLAACEKRGIRVRLLSAAVANQVFKTEKKPKVFGIAKVPPAGRFADLESLSGDVVL
  LDGVKIVGNIGAIVRTRSALGAAGIVLVDSGLGTIADRRLIRASRGYVFSLPIVLATRDE
  ALAFFRDGGMRPVVFEADGKLSIGELDGIDERLVLVFGSEKTGPSGEFAGVATESVSIPM
  NPAAESLNVSVSAGIALHRRARRNLSRPRG
• Function: Specifically methylates the adenosine-1067 in 23S ribosomal RNA. Confers resistance to antibiotic thiostrepton.
• Uniprot ID: TSNR_STRLU

Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Streptomycetales
Family: Streptomycetaceae
Genus: Streptomyces
Species: Streptomyces laurentii

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Clinical Trial Drug(s) 1 drug(s) in total

Thiostrepton

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Streptomyces laurentii infection [1]

• Resistant Disease: Streptomyces laurentii infection [ICD-11: 1C43.9]
• Resistant Drug: Thiostrepton
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli strain XL-1 Blue MRF; 562
• In Vitro Model: Streptomyces laurentii strain; 39478
• In Vitro Model: Streptomyces lividans strain Tk24; 457428
• Experiment for Molecule Alteration: DNA hybridizations assay
• Mechanism Description: The Th R (tsnR) gene from SI is highly similar to the Th R and Nh R genes from Saz and Sac. Partial nt sequence analysis of the DNA flanking the Sl tsnR gene indicates that tsnR is clustered with r-protein operons. Insert-directed integration of pkCl132 within this region supports the idea that, in S1, tsnR is not clustered with genes encoding Th biosynthetic enzymes.

Disease Class: Streptomyces lividans infection [1]

• Resistant Disease: Streptomyces lividans infection [ICD-11: 1C43.8]
• Resistant Drug: Thiostrepton
• Molecule Alteration: Expression; Acquired
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli strain XL-1 Blue MRF; 562
• In Vitro Model: Streptomyces laurentii strain; 39478
• In Vitro Model: Streptomyces lividans strain Tk24; 457428
• Experiment for Molecule Alteration: DNA hybridizations assay
• Mechanism Description: The Th R (tsnR) gene from SI is highly similar to the Th R and Nh R genes from Saz and Sac. Partial nt sequence analysis of the DNA flanking the Sl tsnR gene indicates that tsnR is clustered with r-protein operons. Insert-directed integration of pkCl132 within this region supports the idea that, in S1, tsnR is not clustered with genes encoding Th biosynthetic enzymes.

References

• Ref 1: The thiostrepton-resistance-encoding gene in Streptomyces laurentii is located within a cluster of ribosomal protein operons. Gene. 1995 Oct 16;164(1):137-42. doi: 10.1016/0378-1119(95)00442-9.