Molecule Information

General Information of the Molecule (ID: Mol00735)

• Name: Aminoglycoside 6-adenylyltransferase AadS (AAADS) ,Bacteroides ovatus
• Molecule Type: Protein
• Gene Name: F3F51_25225
• Sequence:
  MKVREEKLRTIIEWSEKNEDVRVLLLTSSLVNPLALVDEFSDLDIEFVFEDNTNYISDKS
  WTLKFGNPIAMIEEDESCFNHKHAMKMLLYEDGVKVDFKLYSKSKFIKETQEKELPEDWD
  IGYKILIDKDGITKQMLKPTYQISIIKKPSEKEFQNLINDFWWDTTYVAKCLVRDEIFYA
  KFMSETVIRTEYLIPLIEWHIASEHNWNITTNKYGRLFKKYLNQEMWAKTEQTFSGSDIK
  ENWTALFSMTDLVSEIGTELSKKLEYKYPDKLENDIRKYLAGLKPKT
• Uniprot ID: A0A6N3V4B7_BACOV

Kingdom: N.A.
Phylum: Bacteroidetes
Class: Bacteroidia
Order: Bacteroidales
Family: Bacteroidaceae
Genus: Bacteroides
Species: Bacteroides ovatus

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Streptomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Streptomycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Bacteroides fragilis strain IB131; 817
• In Vitro Model: Bacteroides ovatus strains IB106; 28116
• In Vitro Model: Bacteroides ovatus strains IB136; 28116
• In Vitro Model: Bacteroides uniformis strain IB128; 820
• Experiment for Molecule Alteration: Whole genome sequence assay
• Experiment for Drug Resistance: Agar dilution method assay
• Mechanism Description: The aadS-encoded peptide displayed significant homology to Gram-positive streptomycin-dependent adenyltransferases, and enzymatic analysis confirmed the production of this activity.

References

• Ref 1: Activation of a cryptic streptomycin-resistance gene in the Bacteroides erm transposon, Tn4551. Mol Microbiol. 1992 Aug;6(16):2287-97. doi: 10.1111/j.1365-2958.1992.tb01404.x.