Molecule Information

General Information of the Molecule (ID: Mol00684)

Name	E3 ubiquitin-protein ligase TRIM31 (TRIM31) ,Homo sapiens
Synonyms	RING-type E3 ubiquitin transferase TRIM31; Tripartite motif-containing protein 31; C6orf13; RNF Click to Show/Hide
Molecule Type	Protein
Gene Name	TRIM31
Gene ID	11074
Location	chr6:30102897-30113090[-]
Sequence	MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSV RKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQEMFHYFCEDDGKFLCFVCRES KDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQR ILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQN MPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQAD RKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHS LFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFC EVPSS Click to Show/Hide
Function	Regulator of Src-induced anchorage independent cell growth (By similarity). May have E3 ubiquitin-protein ligase activity. Click to Show/Hide
Uniprot ID	TRI31_HUMAN
Ensembl ID	ENSG00000204616
HGNC ID	HGNC:16289
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Cisplatin

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Ovarian cancer				[1]
Sensitive Disease	Ovarian cancer [ICD-11: 2C73.0]			Disease Info
Sensitive Drug	Cisplatin			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	SkOV3 cells	Ovary	Homo sapiens (Human)	CVCL_0532
	HEK293T cells	Kidney	Homo sapiens (Human)	CVCL_0063
	8910 cells	Ovary	Homo sapiens (Human)	N.A.
In Vivo Model	Nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Western blot analysis
Experiment for Drug Resistance	CCK8 assay; Soft agar colony formation assay
Mechanism Description	Down-regulation of Foxo3 and TRIM31 by miR551b in side population promotes cell proliferation, invasion, and drug resistance of ovarian cancer.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Click to Show/Hide the Resistance Disease of This Class

Ovarian cancer [ICD-11: 2C73]

Click to Show/Hide

Differential expression of molecule in resistant diseases
The Studied Tissue	Ovary
The Specified Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.95E-02; Fold-change: 1.24E-01; Z-score: 4.61E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.10E-04; Fold-change: 5.38E-02; Z-score: 2.72E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances		Click to View the Clearer Original Diagram
Download Molecule expression barchart for all samples Download Molecule expression data of patients in the normal section of the tissue adjacent to the disease section Download Molecule expression data of patients in the disease section of the tissue Download Molecule expression data in the tissue of healthy individual

Tissue-specific Molecule Abundances in Healthy Individuals

Click to Show/Hide the Molecule Abundances


Download the Tissue-Specific Variation(s) Profile

References

Ref 1	Downregulation of Foxo3 and TRIM31 by miR-551b in side population promotes cell proliferation, invasion, and drug resistance of ovarian cancer. Med Oncol. 2016 Nov;33(11):126. doi: 10.1007/s12032-016-0842-9. Epub 2016 Oct 14.