Molecule Information

General Information of the Molecule (ID: Mol00675)

Name	Transmembrane protein 54 (TMM54) ,Homo sapiens
Synonyms	Beta-casein-like protein; Protein CAC-1; BCLP; CAC1 Click to Show/Hide
Molecule Type	Protein
Gene Name	TMEM54
Gene ID	113452
Location	chr1:32894594-32901438[-]
Sequence	MCLRLGGLSVGDFRKVLMKTGLVLVVLGHVSFITAALFHGTVLRYVGTPQDAVALQYCVV NILSVTSAIVVITSGIAAIVLSRYLPSTPLRWTVFSSSVACALLSLTCALGLLASIAMTF ATQGKALLAACTFGSSELLALAPDCPFDPTRIYSSSLCLWGIALVLCVAENVFAVRCAQL THQLLELRPWWGKSSHHMMRENPELVEGRDLLSCTSSEPLTL Click to Show/Hide
Uniprot ID	TMM54_HUMAN
Ensembl ID	ENSG00000121900
HGNC ID	HGNC:24143
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Vincristine

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Colorectal cancer				[1]
Sensitive Disease	Colorectal cancer [ICD-11: 2B91.1]			Disease Info
Sensitive Drug	Vincristine			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Identified from the Human Clinical Data
Cell Pathway Regulation	Cell apoptosis		Activation	hsa04210
	Cell migration		Inhibition	hsa04670
	Cell proliferation		Inhibition	hsa05200
In Vitro Model	HCT-8 cells	Colon	Homo sapiens (Human)	CVCL_2478
In Vivo Model	BALB/c nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Western blotting analysis
Experiment for Drug Resistance	MTT assay
Mechanism Description	miR-199a-5p over-expression is able to inhibit CRC cell proliferation and reverse tumor cell drug resistance in vitro and in vivo, partly through suppressing the expression of CAC1 protein at the post-transcriptional level in CRC.

References

Ref 1	The deoxycholic acid targets miRNA-dependent CAC1 gene expression in multidrug resistance of human colorectal cancer. Int J Biochem Cell Biol. 2012 Dec;44(12):2321-32. doi: 10.1016/j.biocel.2012.08.006. Epub 2012 Aug 10.