Molecule Information

General Information of the Molecule (ID: Mol00652)

• Name: START domain-containing protein 10 (STARD10) ,Homo sapiens
• Synonyms: StARD10; Antigen NY-CO-28; PCTP-like protein; PCTP-L; Serologically defined colon cancer antigen 28; StAR-related lipid transfer protein 10; SDCCAG28; CGI-52
• Molecule Type: Protein
• Gene Name: STARD10
• Gene ID: 10809
• Location: chr11:72754729-72794047[-]
• Sequence:
  MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVE
  MDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWR
  CPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKS
  CVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPE
  QSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT
• Function: May play metabolic roles in sperm maturation or fertilization (By similarity). Phospholipid transfer protein that preferentially selects lipid species containing a palmitoyl or stearoyl chain on the sn-1 and an unsaturated fatty acyl chain (18:1 or 18:2) on the sn-2 position. Able to transfer phosphatidylcholine (PC) and phosphatidyetanolamline (PE) between membranes.
• Uniprot ID: STA10_HUMAN
• Ensembl ID: ENSG00000214530
• HGNC ID: HGNC:10666

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Docetaxel

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Breast cancer [1]

• Sensitive Disease: Breast cancer [ICD-11: 2C60.3]
• Sensitive Drug: Docetaxel
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Identified from the Human Clinical Data
• Cell Pathway Regulation: STARD10 signaling pathway; Inhibition; hsa05206
• In Vitro Model: MCF-7 cells; Breast; Homo sapiens (Human); CVCL_0031
• In Vitro Model: MDA-MB-231 cells; Breast; Homo sapiens (Human); CVCL_0062
• In Vitro Model: T47D cells; Breast; Homo sapiens (Human); CVCL_0553
• In Vitro Model: MDA-MB-468 cells; Breast; Homo sapiens (Human); CVCL_0419
• Experiment for Molecule Alteration: RT-qPCR; Immunoblotting assay; Luciferase assay
• Experiment for Drug Resistance: ELISA; MTT assay; Transwell invasion assay
• Mechanism Description: Acquired resistance to DTX is caused by the miR638 deficiency and subsequent STARD10 upregulation.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Breast cancer [ICD-11: 2C60]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Breast tissue
• The Specified Disease: Breast cancer
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 2.42E-62; Fold-change: 1.37E+00; Z-score: 1.54E+00
• The Expression Level of Disease Section Compare with the Adjacent Tissue: p-value: 2.45E-08; Fold-change: 1.02E+00; Z-score: 7.43E-01

References

• Ref 1: Potentiation of docetaxel sensitivity by miR-638 via regulation of STARD10 pathway in human breast cancer cells. Biochem Biophys Res Commun. 2017 May 27;487(2):255-261. doi: 10.1016/j.bbrc.2017.04.045. Epub 2017 Apr 12.